Mouse Anti-CDKN2A Antibody (clone P1), mRNA
CAT#: HPAB-M0037-YC-mRNA
This mRNA encodes a Mouse antibody against CDKN2A. It contains two mRNAs that encode for the heavy and light chains of the antibody.
Gene Expression
Subcellular Location
Figure 1 IF staining of human cell line PC-3
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli.
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/47838/979_F9_4_selected.jpg
Normal Tissue
Figure 2 IHC staining of human stomach
Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/93/ihc_selected.jpg
Normal Tissue
Figure 3 Tonsil
High expression in tonsil
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_4_8_val_selected.jpg
Normal Tissue
Figure 4 IHC staining of human tonsil
Immunohistochemical staining of human tonsil shows strong positivity in a subset of cells.
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/18232/ihc_selected.jpg
Normal Tissue
Figure 5 Lymph node
Germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: nuclear Non-germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_8.jpg
Normal Tissue
Figure 6 Kidney
Cells in glomeruli Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear Cells in tubules Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous nuclear
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_5.jpg
RNA Expression
Figure 7 RNA cell line category: Cell line enhanced (CAPAN-2, HEK93, HeLa, SK-MEL-30)
Cell lines ordered by descending RNA expression order
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000147889-CDKN2A
❮
❯
Specifications
- Immunogen
- CDKN2A epitope polypeptide: ATERIYHFVVGQMVYYQCVQGYRALHRGPAESV, conjugated to KLH
- Host Species
- Mouse
- Specificity
- Human CDKN2A
- Species Reactivity
- Human
- Clone
- P1
Product Property
- Purity
- >95%
- Storage
- Store at -20°C.
Target
- Alternative Names
- Cyclin Dependent Kinase Inhibitor 2A; Cyclin-Dependent Kinase Inhibitor 2A (Melanoma, P16, Inhibits CDK4); Cyclin-Dependent Kinase 4 Inhibitor A; Cyclin-Dependent Kinase Inhibitor 2A; Multiple Tumor Suppressor 1; Alternative Reading Frame; P16-INK4A; P16INK4A; P14ARF; CDKN2; CDK4I; MTS-1; MTS1; MLM;
- Gene ID
- 1029
- UniProt ID
- P42771
REVIEWS AND Q&AS
CITATIONS
RESOURCES
DOWNLOADS
RELATED PRODUCTS
Inquiry
Navs
Customer Review
There are currently no Customer reviews or questions for HPAB-M0037-YC-mRNA. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number:
See other products for "Clone P1"
- CAT
- Product Name
See other products for "CDKN2A"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1779z | Mouse Anti-CDKN2A Recombinant Antibody (clone 30C1) | WB, ELISA, FC, ICC, IF, IHC | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-2201MZ | Recombinant Mouse Anti-Human CDKN2A Antibody (clone 25Q03 (tbnf bt EDT-350)) | ICC, IF, IP, WB | Mouse antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| BRD-0116MZ | Chicken Anti-CDKN2A Polyclonal IgY | WB | Chicken antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-0642 | Hi-Affi™ Rabbit Anti-CDKN2A Recombinant Antibody (clone DS642AB) | FC, ICC, IF, WB | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0877LY-S(P) | Mouse Anti-CDKN2A Recombinant Antibody (clone CBL015); scfv Fragment | IHC, WB | Mouse scfv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0877LY | Mouse Anti-CDKN2A Recombinant Antibody (clone CBL015) | IHC, WB | Mouse IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0877LY-F(E) | Mouse Anti-CDKN2A Recombinant Antibody (clone CBL015); Fab Fragment | IHC, WB | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MRO-1141-CN | Rabbit Anti-CDKN2A Recombinant Antibody (clone CBACN-415) | WB, IF, IHC, IP, FC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MRO-1769-CN | Rabbit Anti-CDKN2A Polyclonal Antibody (MRO-1769-CN) | WB, IF, IHC, FC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-M0037-YC-S(P) | Mouse Anti-CDKN2A Recombinant Antibody (clone P1); scFv Fragment | ELISA | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-M0037-YC-F(E) | Mouse Anti-CDKN2A Recombinant Antibody (clone P1); Fab Fragment | ELISA | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0724-YC1355 | AbPlus™ Anti-CDKN2A Magnetic Beads (VS-0724-YC1355) | IP, Protein Purification |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0325-XY414 | Anti-CDKN2A Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY1341 | Anti-Rat CDKN2A Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY1340 | Anti-Human CDKN2A Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-1025-YC16 | Anti-CDKN2A Antibody Prodrug, Protease Activated (VS-1025-YC16) | ISZ, Cyt, FuncS |
Specific Inquiry
Add to compare
See Our Custom Production in Action
Popular Products
Application: IF, IP, Neut, FuncS, ELISA, FC, WB
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application:
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: Neut, ELISA, IF, IP, FuncS, FC
Application: IF, IP, Neut, FuncS, ELISA, FC
Application: ELISA, FC, FuncS
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
