Mouse Anti-CDKN2A Antibody (clone P1), mRNA

CAT#: HPAB-M0037-YC-mRNA

This mRNA encodes a Mouse antibody against CDKN2A. It contains two mRNAs that encode for the heavy and light chains of the antibody.

Gene Expression
Figure 1 IF staining of human cell line PC-3 Figure 2 IHC staining of human stomach Figure 3 Tonsil Figure 4 IHC staining of human tonsil Figure 5 Lymph node Figure 6 Kidney Figure 7 RNA cell line category: Cell line enhanced (CAPAN-2, HEK93, HeLa, SK-MEL-30)

Specifications

  • Immunogen
  • CDKN2A epitope polypeptide: ATERIYHFVVGQMVYYQCVQGYRALHRGPAESV, conjugated to KLH
  • Host Species
  • Mouse
  • Specificity
  • Human CDKN2A
  • Species Reactivity
  • Human
  • Clone
  • P1

Product Property

  • Purity
  • >95%
  • Storage
  • Store at -20°C.

Target

  • Alternative Names
  • Cyclin Dependent Kinase Inhibitor 2A; Cyclin-Dependent Kinase Inhibitor 2A (Melanoma, P16, Inhibits CDK4); Cyclin-Dependent Kinase 4 Inhibitor A; Cyclin-Dependent Kinase Inhibitor 2A; Multiple Tumor Suppressor 1; Alternative Reading Frame; P16-INK4A; P16INK4A; P14ARF; CDKN2; CDK4I; MTS-1; MTS1; MLM;
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-M0037-YC-mRNA. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "Clone P1"

See other products for "CDKN2A"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
MOB-1779z Mouse Anti-CDKN2A Recombinant Antibody (clone 30C1) WB, ELISA, FC, ICC, IF, IHC Mouse IgG1
CAT Product Name Application Type
MOB-2201MZ Recombinant Mouse Anti-Human CDKN2A Antibody (clone 25Q03 (tbnf bt EDT-350)) ICC, IF, IP, WB Mouse antibody
CAT Product Name Application Type
BRD-0116MZ Chicken Anti-CDKN2A Polyclonal IgY WB Chicken antibody
CAT Product Name Application Type
MOR-0642 Hi-Affi™ Rabbit Anti-CDKN2A Recombinant Antibody (clone DS642AB) FC, ICC, IF, WB Rabbit IgG
CAT Product Name Application Type
HPAB-0877LY-S(P) Mouse Anti-CDKN2A Recombinant Antibody (clone CBL015); scfv Fragment IHC, WB Mouse scfv
CAT Product Name Application Type
HPAB-0877LY Mouse Anti-CDKN2A Recombinant Antibody (clone CBL015) IHC, WB Mouse IgG
CAT Product Name Application Type
MRO-1141-CN Rabbit Anti-CDKN2A Recombinant Antibody (clone CBACN-415) WB, IF, IHC, IP, FC Rabbit IgG
CAT Product Name Application Type
MRO-1769-CN Rabbit Anti-CDKN2A Polyclonal Antibody (MRO-1769-CN) WB, IF, IHC, FC Rabbit IgG
CAT Product Name Application Type
VS-0724-YC1355 AbPlus™ Anti-CDKN2A Magnetic Beads (VS-0724-YC1355) IP, Protein Purification
CAT Product Name Application Type
VS-0325-XY414 Anti-CDKN2A Immunohistochemistry Kit IHC
CAT Product Name Application Type
VS-0525-XY1341 Anti-Rat CDKN2A Immunohistochemistry Kit IHC
CAT Product Name Application Type
VS-0525-XY1340 Anti-Human CDKN2A Immunohistochemistry Kit IHC
CAT Product Name Application Type
VS-1025-YC16 Anti-CDKN2A Antibody Prodrug, Protease Activated (VS-1025-YC16) ISZ, Cyt, FuncS
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare