Mouse Anti-CDKN2A Antibody (clone P1), mRNA (CAT#: HPAB-M0037-YC-mRNA)
This mRNA encodes a Mouse antibody against CDKN2A. It contains two mRNAs that encode for the heavy and light chains of the antibody.
Specific Inquiry
Subcellular Location
Normal Tissue
RNA Expression
Figure 1 IF staining of human cell line PC-3
(Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/47838/979_F9_4_selected.jpg
(Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/47838/979_F9_4_selected.jpg
Figure 2 IHC staining of human stomach
(Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/93/ihc_selected.jpg
(Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/93/ihc_selected.jpg
Figure 3 Tonsil
(High expression in tonsil)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_4_8_val_selected.jpg
(High expression in tonsil)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_4_8_val_selected.jpg
Figure 4 IHC staining of human tonsil
(Immunohistochemical staining of human tonsil shows strong positivity in a subset of cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/18232/ihc_selected.jpg
(Immunohistochemical staining of human tonsil shows strong positivity in a subset of cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/18232/ihc_selected.jpg
Figure 5 Lymph node
(Germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: nuclear Non-germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_8.jpg
(Germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: nuclear Non-germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_8.jpg
Figure 6 Kidney
(Cells in glomeruli Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear Cells in tubules Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_5.jpg
(Cells in glomeruli Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear Cells in tubules Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_5.jpg
Figure 7 RNA cell line category: Cell line enhanced (CAPAN-2, HEK93, HeLa, SK-MEL-30)
(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000147889-CDKN2A
(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000147889-CDKN2A
Specifications
- Immunogen
- CDKN2A epitope polypeptide: ATERIYHFVVGQMVYYQCVQGYRALHRGPAESV, conjugated to KLH
- Host Species
- Mouse
- Specificity
- Human CDKN2A
- Species Reactivity
- Human
- Clone
- P1
Product Property
- Purity
- >95%
- Storage
- Store at -20°C.
Target
- Alternative Names
- Cyclin Dependent Kinase Inhibitor 2A; Cyclin-Dependent Kinase Inhibitor 2A (Melanoma, P16, Inhibits CDK4); Cyclin-Dependent Kinase 4 Inhibitor A; Cyclin-Dependent Kinase Inhibitor 2A; Multiple Tumor Suppressor 1; Alternative Reading Frame; P16-INK4A; P16INK4A; P14ARF; CDKN2; CDK4I; MTS-1; MTS1; MLM;
- Gene ID
- 1029
- UniProt ID
- P42771
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "Clone P1"
See other products for "CDKN2A"
Select a product category from the dropdown menu below to view related products.
Please select product type
IgG Antibody Products
Chicken IgY Antibody Products
Rabbit Monoclonal Antibody Products
ScFv Antibody Products
Fab Antibody Products
Antibody Magnetic Beads
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-2201MZ | Recombinant Mouse Anti-Human CDKN2A Antibody (clone 25Q03 (tbnf bt EDT-350)) | ICC/IF, IP, WB | Mouse antibody |
| ZG-0795F | Mouse Anti-CDKN2A Recombinant Antibody (clone DCS50.1) | WB, IP, IHC | Mouse IgG1 |
| VS3-XY481 | Mouse Anti-CDKN2A Recombinant Antibody (clone 1D7D2) | ELISA, WB, IHC, FC | Mouse IgG1 |
| VS3-XY482 | Mouse Anti-CDKN2A Recombinant Antibody (clone 1D7D2A1) | ELISA, WB, IHC, FC | Mouse IgG1 |
| VS3-XY483 | Mouse Anti-CDKN2A Recombinant Antibody (clone 3B12) | ELISA, WB, IHC, FC | Mouse IgG1 |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for HPAB-M0037-YC-mRNA. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: IF, IP, Neut, FuncS, ELISA, FC, WB
Application: WB, ELISA, FC, IP, FuncS, IF, Neut
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: IF, IP, Neut, FuncS, ELISA, FC, WB
Application: Neut, Inhib, FC, ELISA
Application: FC, IB, Block, Inhib, FuncS, ELISA, FACS, IP, IF
Application: ELISA, FC, Inhib, FuncS
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
