Mouse Anti-CDKN2A Recombinant Antibody (clone P1) (CAT#: HPAB-M0037-YC)

Provided is a cancer-related gene CDKN2A epitope polypeptide monoclonal antibody. According to the gene CDKN2A monoclonal antibody, the high-conservative protein sequence of a gene CDKN2A serves as target protein, epitope polypeptide is designed and synthesized and coupled with the carrier protein to serve as immunogen, and the gene CDKN2A monoclonal antibody is obtained through the immunogen. The monoclonal antibody and the designed and synthesized epitope polypeptide can be used for detecting quantitative expression of human blood or the tissue CDKN2A antibody, has the advantages of high specificity and high sensitivity, and will be widely applied to clinical detection and experimental studies.

Specific Inquiry
  • Size:

  • Conjugation:

  • Endotoxin:

  • Purity:

  • Formats:

  • Isotype Switching:

  • Fc Engineering:

  • Modalities:

Custom Production

We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

Sequences:
Isotype :
Purity :
Endotoxin :
Quantity :
Conjugation :
Fc Engineering :
Modalities :
Other Requirements:
We require custom production
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location
Normal Tissue
RNA Expression

Specifications

  • Immunogen
  • CDKN2A epitope polypeptide: ATERIYHFVVGQMVYYQCVQGYRALHRGPAESV, conjugated to KLH
  • Host Species
  • Mouse
  • Type
  • Mouse IgG
  • Specificity
  • Human CDKN2A
  • Species Reactivity
  • Human
  • Clone
  • P1
  • Applications
  • ELISA

Product Property

  • Purity
  • >95% as determined by SDS-PAGE and HPLC analysis
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • Cyclin Dependent Kinase Inhibitor 2A; Cyclin-Dependent Kinase Inhibitor 2A (Melanoma, P16, Inhibits CDK4); Cyclin-Dependent Kinase 4 Inhibitor A; Cyclin-Dependent Kinase Inhibitor 2A; Multiple Tumor Suppressor 1; Alternative Reading Frame; P16-INK4A; P16INK4A; P14ARF; CDKN2; CDK4I; MTS-1; MTS1; MLM;

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "Clone P1"

See other products for "CDKN2A"

Select a product category from the dropdown menu below to view related products.
Please select product type
Chicken IgY Antibody Products Rabbit Monoclonal Antibody Products ScFv Antibody Products Fab Antibody Products IgG Antibody Products Antibody Magnetic Beads IHC Kit and Antibody Products: Precision Tools for Immunohistochemistry
CAT Product Name Application Type
BRD-0116MZ Chicken Anti-CDKN2A Polyclonal IgY WB Chicken antibody

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-M0037-YC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare