Mouse Anti-CDKN2A Recombinant Antibody (clone P1)
CAT#: HPAB-M0037-YC
Provided is a cancer-related gene CDKN2A epitope polypeptide monoclonal antibody. According to the gene CDKN2A monoclonal antibody, the high-conservative protein sequence of a gene CDKN2A serves as target protein, epitope polypeptide is designed and synthesized and coupled with the carrier protein to serve as immunogen, and the gene CDKN2A monoclonal antibody is obtained through the immunogen. The monoclonal antibody and the designed and synthesized epitope polypeptide can be used for detecting quantitative expression of human blood or the tissue CDKN2A antibody, has the advantages of high specificity and high sensitivity, and will be widely applied to clinical detection and experimental studies.
Specifications
- Immunogen
- CDKN2A epitope polypeptide: ATERIYHFVVGQMVYYQCVQGYRALHRGPAESV, conjugated to KLH
- Host Species
- Mouse
- Type
- Mouse IgG
- Specificity
- Human CDKN2A
- Species Reactivity
- Human
- Clone
- P1
- Applications
- ELISA
Product Property
- Purity
- >95% as determined by SDS-PAGE and HPLC analysis
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
- Alternative Names
- Cyclin Dependent Kinase Inhibitor 2A; Cyclin-Dependent Kinase Inhibitor 2A (Melanoma, P16, Inhibits CDK4); Cyclin-Dependent Kinase 4 Inhibitor A; Cyclin-Dependent Kinase Inhibitor 2A; Multiple Tumor Suppressor 1; Alternative Reading Frame; P16-INK4A; P16INK4A; P14ARF; CDKN2; CDK4I; MTS-1; MTS1; MLM;
- Gene ID
- 1029
- UniProt ID
- P42771
Customer Review
There are currently no Customer reviews or questions for HPAB-M0037-YC. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "Clone P1"
- CAT
- Product Name
See other products for "CDKN2A"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1779z | Mouse Anti-CDKN2A Recombinant Antibody (clone 30C1) | WB, ELISA, FC, ICC, IF, IHC | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-2201MZ | Recombinant Mouse Anti-Human CDKN2A Antibody (clone 25Q03 (tbnf bt EDT-350)) | ICC, IF, IP, WB | Mouse antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| BRD-0116MZ | Chicken Anti-CDKN2A Polyclonal IgY | WB | Chicken antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-0642 | Hi-Affi™ Rabbit Anti-CDKN2A Recombinant Antibody (clone DS642AB) | FC, ICC, IF, WB | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0877LY-S(P) | Mouse Anti-CDKN2A Recombinant Antibody (clone CBL015); scfv Fragment | IHC, WB | Mouse scfv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0877LY | Mouse Anti-CDKN2A Recombinant Antibody (clone CBL015) | IHC, WB | Mouse IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0877LY-F(E) | Mouse Anti-CDKN2A Recombinant Antibody (clone CBL015); Fab Fragment | IHC, WB | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MRO-1141-CN | Rabbit Anti-CDKN2A Recombinant Antibody (clone CBACN-415) | WB, IF, IHC, IP, FC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MRO-1769-CN | Rabbit Anti-CDKN2A Polyclonal Antibody (MRO-1769-CN) | WB, IF, IHC, FC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-M0037-YC-S(P) | Mouse Anti-CDKN2A Recombinant Antibody (clone P1); scFv Fragment | ELISA | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-M0037-YC-F(E) | Mouse Anti-CDKN2A Recombinant Antibody (clone P1); Fab Fragment | ELISA | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0724-YC1355 | AbPlus™ Anti-CDKN2A Magnetic Beads (VS-0724-YC1355) | IP, Protein Purification |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0325-XY414 | Anti-CDKN2A Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY1341 | Anti-Rat CDKN2A Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY1340 | Anti-Human CDKN2A Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-1025-YC16 | Anti-CDKN2A Antibody Prodrug, Protease Activated (VS-1025-YC16) | ISZ, Cyt, FuncS |
Popular Products

Application: FuncS, IF, Neut, ELISA, FC, IP, ICC

Application: ELISA, Neut, IF, IP, FC, FuncS

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: WB, IP, IF, FuncS, FC, Neut, ELISA

Application: FC, IP, ELISA, Neut, FuncS, IF, WB

Application: IF, IP, Neut, FuncS, ELISA, FC, WB

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: WB, FC, IP, ELISA, Neut, FuncS, IF

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: FuncS, IF, Neut, ELISA, FC, IP, ICC

Application: ELISA, WB, BLI, SPR
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.











