Mouse Anti-CDKN2A Recombinant Antibody (clone P1); Fab Fragment (CAT#: HPAB-M0037-YC-F(E))
Provided is a cancer-related gene CDKN2A epitope polypeptide monoclonal antibody. According to the gene CDKN2A monoclonal antibody, the high-conservative protein sequence of a gene CDKN2A serves as target protein, epitope polypeptide is designed and synthesized and coupled with the carrier protein to serve as immunogen, and the gene CDKN2A monoclonal antibody is obtained through the immunogen. The monoclonal antibody and the designed and synthesized epitope polypeptide can be used for detecting quantitative expression of human blood or the tissue CDKN2A antibody, has the advantages of high specificity and high sensitivity, and will be widely applied to clinical detection and experimental studies.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/47838/979_F9_4_selected.jpg

(Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/93/ihc_selected.jpg

(High expression in tonsil)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_4_8_val_selected.jpg

(Immunohistochemical staining of human tonsil shows strong positivity in a subset of cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/18232/ihc_selected.jpg

(Germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: nuclear Non-germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_8.jpg

(Cells in glomeruli Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear Cells in tubules Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_5.jpg

(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000147889-CDKN2A
Specifications
- Immunogen
- CDKN2A epitope polypeptide: ATERIYHFVVGQMVYYQCVQGYRALHRGPAESV, conjugated to KLH
- Host Species
- Mouse
- Type
- Mouse Fab
- Specificity
- Human CDKN2A
- Species Reactivity
- Human
- Clone
- P1
- Applications
- ELISA
Product Property
- Purity
- >95% as determined by SDS-PAGE and HPLC analysis
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
- Alternative Names
- Cyclin Dependent Kinase Inhibitor 2A; Cyclin-Dependent Kinase Inhibitor 2A (Melanoma, P16, Inhibits CDK4); Cyclin-Dependent Kinase 4 Inhibitor A; Cyclin-Dependent Kinase Inhibitor 2A; Multiple Tumor Suppressor 1; Alternative Reading Frame; P16-INK4A; P16INK4A; P14ARF; CDKN2; CDK4I; MTS-1; MTS1; MLM;
- Gene ID
- 1029
- UniProt ID
- P42771
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "Clone P1"
See other products for "CDKN2A"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MOB-1779z | Mouse Anti-CDKN2A Recombinant Antibody (clone 30C1) | WB, ELISA, FC, ICC, IF, IHC | Mouse IgG1 |
ZG-0333C | Mouse Anti-CDKN2A Recombinant Antibody (ZG-0333C) | WB, IHC, ELISA | Mouse IgG |
ZG-0334C | Mouse Anti-CDKN2A Recombinant Antibody (ZG-0334C) | WB, IHC, ELISA | Mouse IgG |
ZG-0335C | Mouse Anti-CDKN2A Recombinant Antibody (ZG-0335C) | WB, IHC, ELISA | Mouse IgG |
VS3-FY2607 | Rabbit Anti-CDKN2A Recombinant Antibody (VS3-FY2607) | WB, ICC, IP | Rabbit IgG |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for HPAB-M0037-YC-F(E). Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: WB, IP, IF, FuncS, FC, Neut, ELISA
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: FC, IHC, FuncS, Inhib, Cyt
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: WB, IHC, FC, Cyt, ELISA
Application: ELISA, Neut, FuncS
Application: FC, FRET, Internalization
Application: ELISA, PD, Activ, PK, Stim
Application: ELISA, FC, Neut, Inhib
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.