Human Anti-TMCC3 Recombinant Antibody; Fab Fragment (TAB-701CT-F(E))
CAT#: TAB-701CT-F(E)
This product is a recombinant Human antibody Fab fragment that recognizes TMCC3. The antibody was purified by affinity chromatography.
Specifications
- Immunogen
- TMCC3 (VNKPKYGSDDECSSGTSGSADSNGNQSFGAGGASTLDSQGKLAVI)
- Host Species
- Human
- Type
- Human Fab
- Specificity
- Human TMCC3
- Species Reactivity
- Human
- Applications
- ELISA, FC, WB, IHC
- Related Disease
- Breasr cancer, cervical cancer, prostate cancer, pancreatic cancer, lung cancer, glioblastoma, skin cancer,
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
Customer Review
There are currently no Customer reviews or questions for TAB-701CT-F(E). Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Protocol & Troubleshooting
We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.
See other products for "TMCC3"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-699CT | Human Anti-TMCC3 Recombinant Antibody (TAB-699CT) | ELISA, FC, WB, IHC | Human antibody |
| TAB-699CT-S(P) | Human Anti-TMCC3 Recombinant Antibody; scFv Fragment (TAB-699CT-S(P)) | ELISA, FC, WB, IHC | Human scFv |
| TAB-700CT-S(P) | Human Anti-TMCC3 Recombinant Antibody; scFv Fragment (TAB-700CT-S(P)) | ELISA, FC, WB, IHC | Human scFv |
| TAB-701CT-S(P) | Human Anti-TMCC3 Recombinant Antibody; scFv Fragment (TAB-701CT-S(P)) | ELISA, FC, WB, IHC | Human scFv |
| TAB-702CT-S(P) | Human Anti-TMCC3 Recombinant Antibody; scFv Fragment (TAB-702CT-S(P)) | ELISA, FC, WB, IHC | Human scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-YC99 | Recombinant Anti-TMCC3 Vesicular Antibody, EV Displayed (VS-0425-YC99) | ELISA, FC, Cell-uptake |
Popular Products

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: Block, Cyt, FuncS, Inhib

Application: FC, IHC-Fr, IP, ELISA, Block

Application: ELISA, FC, IF, IHC, WB

Application: ELISA, Block, WB, FC, IP

Application: ELISA, Inhib, FuncS
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.










-3.jpg)






