Rcombinant Anti-Human YAP1 Antibody. (CAT#: MOB-0305MC)

Recombinant Mouse Antibody specifically binds to Human YAP1.

Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Formats:
  • Isotype Switching:
  • Fc Engineering:
  • Modalities:
  • Datasheet
  • MSDS
  • COA

Specifications

  • Immunogen
  • YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
    QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
  • Host Species
  • Mouse
  • Specificity
  • YAP1 - Yes-associated protein 1, 65kDa
  • Species Reactivity
  • Human, Mouse
  • Clone
  • 3G23

Product Property

  • Purity
  • IgG purified
  • Format
  • Liquid
  • Buffer
  • Phosphate Buffered Saline, pH 7.4
  • Preservative
  • No Preservative
  • Storage
  • Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

Applications

  • Application Notes
  • Western Blot 1:500
    ELISA 1:100-1:2000
    Immunocytochemistry/Immunofluorescence 30 ug/ml
    Immunohistochemistry 1:10-1:500
    Immunohistochemistry-Paraffin 3 ug/ml
    Sandwich ELISA 1:100-1:2000

Target

  • Alternative Names
  • YAP; YKI; COB1; YAP2; YAP65

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "YAP1"

Select a product category from the dropdown menu below to view related products.
Please select product type
Mouse Antibody Products Rabbit Monoclonal Antibody Products IgG Antibody Products Antibody Magnetic Beads
CAT Product Name Application Type
MOB-0306MC Rabbit Anti-Phospho-YAP (Ser127) Antibody WB

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for MOB-0305MC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

  • 0
  • 0
Cart
    Go to compare

    Go to compare