Rcombinant Anti-Human YAP1 Antibody.

CAT#: MOB-0305MC

Recombinant Mouse Antibody specifically binds to Human YAP1.

Specifications

  • Immunogen
  • YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
    QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
  • Host Species
  • Mouse
  • Specificity
  • YAP1 - Yes-associated protein 1, 65kDa
  • Species Reactivity
  • Human, Mouse
  • Clone
  • 3G23

Product Property

  • Purity
  • IgG purified
  • Format
  • Liquid
  • Buffer
  • Phosphate Buffered Saline, pH 7.4
  • Preservative
  • No Preservative
  • Storage
  • Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

Applications

  • Application Notes
  • Western Blot 1:500
    ELISA 1:100-1:2000
    Immunocytochemistry/Immunofluorescence 30 ug/ml
    Immunohistochemistry 1:10-1:500
    Immunohistochemistry-Paraffin 3 ug/ml
    Sandwich ELISA 1:100-1:2000

Target

  • Alternative Names
  • YAP; YKI; COB1; YAP2; YAP65
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for MOB-0305MC. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

Protocol & Troubleshooting

We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.

See other products for "YAP1"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
MOB-0306MC Rabbit Anti-Phospho-YAP (Ser127) Antibody WB
CAT Product Name Application Type
MOR-3899 Rabbit Anti-YAP1 Recombinant Antibody (clone DS3899AB) IHC-P, WB Rabbit IgG
MOR-0048-FY Rabbit Anti-YAP1 Recombinant Antibody (clone AFY0019) ICC, IHC-P, WB Rabbit IgG
CAT Product Name Application Type
VS-0424-XY277 AbPlus™ Anti-YAP1 Magnetic Beads (CBACN-585) IP, Protein Purification
CAT Product Name Application Type
VS13-YC1232 CytoStream™ Rabbit Anti-YAP1 Recombinant Antibody (VS13-YC1232) WB, ICC, IF, IHC-P, IP, FC Rabbit IgG
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare