Rcombinant Anti-Human YAP1 Antibody.
CAT#: MOB-0305MC
Recombinant Mouse Antibody specifically binds to Human YAP1.
Specifications
- Immunogen
- YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
- Host Species
- Mouse
- Antibody Isotype
- IgG2a, κ
- Specificity
- YAP1 - Yes-associated protein 1, 65kDa
- Species Reactivity
- Human, Mouse
- Clone
- 3G23
Product Property
- Purity
- IgG purified
- Format
- Liquid
- Buffer
- Phosphate Buffered Saline, pH 7.4
- Preservative
- No Preservative
- Storage
- Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.
Applications
- Application Notes
- Western Blot 1:500
ELISA 1:100-1:2000
Immunocytochemistry/Immunofluorescence 30 ug/ml
Immunohistochemistry 1:10-1:500
Immunohistochemistry-Paraffin 3 ug/ml
Sandwich ELISA 1:100-1:2000
Target
Customer Review
There are currently no Customer reviews or questions for MOB-0305MC. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Protocol & Troubleshooting
We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.
See other products for "YAP1"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-0306MC | Rabbit Anti-Phospho-YAP (Ser127) Antibody | WB |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-2255CT | Recombinant Mouse anti-Human YAP1 Monoclonal antibody (EML1074) | IHC-P, WB |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-3899 | Rabbit Anti-YAP1 Recombinant Antibody (clone DS3899AB) | IHC-P, WB | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MRO-1607-CN | Rabbit Anti-YAP1 Recombinant Antibody (clone CBACN-585) | WB, IF, IHC, IP, FC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MRO-2393-CN | Rabbit Anti-YAP1 Recombinant Antibody (clone CBACN-678) | WB, IHC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-0048-FY | Rabbit Anti-YAP1 Recombinant Antibody (clone AFY0019) | ICC, IHC-P, WB | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| ZG-0623U | Rabbit Anti-Phospho-YAP1 (S127) Recombinant Antibody (clone 3F3) | ELISA, WB, IHC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS3-QX1256 | Mouse Anti-YAP1 Recombinant Antibody (clone 1A12) | WB, IHC, ICC, FC, ELISA | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0424-XY277 | AbPlus™ Anti-YAP1 Magnetic Beads (CBACN-585) | IP, Protein Purification |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS13-YC1232 | CytoStream™ Rabbit Anti-YAP1 Recombinant Antibody (VS13-YC1232) | WB, ICC, IF, IHC-P, IP, FC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0325-XY2503 | Anti-YAP1 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY7974 | Anti-Mouse YAP1 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY7973 | Anti-Human YAP1 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY7975 | Anti-Rat YAP1 Immunohistochemistry Kit | IHC |
Popular Products

Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

Application: WB, FuncS, IF, Neut, ELISA, FC, IP

Application: ELISA, Neut, IF, IP, FC, FuncS

Application: FuncS, IF, Neut, ELISA, FC, IP, IHC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: FC, IP, ELISA, Neut, FuncS, IF, WB

Application: FC, IP, ELISA, Neut, FuncS, IF, ICC

Application: FC, IHC, FuncS, Inhib, Cyt
-2.png)
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
-2-1.png)
Application: IP, IF, FuncS, FC, Neut, ELISA, IHC

Application: Block, Cyt, FuncS, Inhib
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.










