1 0
Cart
    Inquiry
    Popular Searches: Recombinant Antibody MHC Tetramer T cell Receptor Scaffold Protein

    Rcombinant Anti-Human YAP1 Antibody. (CAT#: MOB-0305MC)

    Recombinant Mouse Antibody specifically binds to Human YAP1.

    Specific Inquiry
    • Size:

    • Conjugation:

    • Endotoxin:

    • Purity:

    • Formats:

    • Isotype Switching:

    • Fc Engineering:

    • Modalities:

    Custom Production

    We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

    Sequences:
    Isotype :
    Purity :
    Endotoxin :
    Quantity :
    Conjugation :
    Fc Engineering :
    Modalities :
    Other Requirements:
    We require custom production
    • Datasheet
    • MSDS
    • COA

    Specifications

    • Immunogen
    • YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
      QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
    • Host Species
    • Mouse
    • Specificity
    • YAP1 - Yes-associated protein 1, 65kDa
    • Species Reactivity
    • Human, Mouse
    • Clone
    • 3G23

    Product Property

    • Purity
    • IgG purified
    • Format
    • Liquid
    • Buffer
    • Phosphate Buffered Saline, pH 7.4
    • Preservative
    • No Preservative
    • Storage
    • Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

    Applications

    • Application Notes
    • Western Blot 1:500
      ELISA 1:100-1:2000
      Immunocytochemistry/Immunofluorescence 30 ug/ml
      Immunohistochemistry 1:10-1:500
      Immunohistochemistry-Paraffin 3 ug/ml
      Sandwich ELISA 1:100-1:2000

    Target

    • Alternative Names
    • YAP; YKI; COB1; YAP2; YAP65

    Product Notes

    This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

    • Increased sensitivity
    • Confirmed specificity
    • High repeatability
    • Excellent batch-to-batch consistency
    • Sustainable supply
    • Animal-free production

    See more details about Hi-Affi™ recombinant antibody benefits.

    Downloads

    Download resources about recombinant antibody development and antibody engineering to boost your research.

    See other products for "YAP1"

    Select a product category from the dropdown menu below to view related products.
    Please select product type
    Mouse Antibody Products IgG Antibody Products Rabbit Monoclonal Antibody Products Antibody Magnetic Beads Flow Cytometry (FC) related Reagents and Kits: Empowering Cell Function Research IHC Kit and Antibody Products: Precision Tools for Immunohistochemistry
    CAT Product Name Application Type
    MOB-0306MC Rabbit Anti-Phospho-YAP (Ser127) Antibody WB

    Customer Reviews and Q&As

    Submit a review or a question

    There are currently no Customer reviews or questions for MOB-0305MC. Click the button above to contact us or submit your feedback about this product.

    Popular products with customers

    Figure 3 Anti-ANGPT2 Therapeutic Antibody (TAB-769) in ELISA

    Anti-ANGPT2 Recombinant Antibody (CAT# TAB-769)
    Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

    Figure 5 Anti-RSV glycoprotein F Recombinant Antibody (TAB-709) in ELISA

    Anti-RSV glycoprotein F Recombinant Antibody (TAB-709) (CAT# TAB-709)
    Application: IF, IP, Neut, FuncS, ELISA, FC, WB

    Figure 3 Anti-Human Abeta Antibody in DB

    Anti-Human Abeta Recombinant Antibody (TAB-229) (CAT# TAB-229)
    Application: FuncS, IF, Neut, ELISA, FC, IP, ICC

    Figure 1 Anti-Human CD70 Recombinant Antibody (TAB-H76) in ELISA

    Anti-Human CD70 Recombinant Antibody (Vorsetuzumab) (CAT# TAB-H76)
    Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

    Figure 3 Human Anti-HIV-1 gp41 Recombinant Antibody (clone 4E10) (PABL-192) in Dot Blot

    Human Anti-HIV-1 gp41 Recombinant Antibody (clone 4E10) (CAT# PABL-192)
    Application: WB, Neut, FuncS

    Figure 1 Recombinant Human Anti-RSV Antibody (PABL-321) in SDS-PAGE

    Recombinant Human Anti-RSV Antibody (AM14) (CAT# PABL-321)
    Application: WB, ELISA, Neut, FuncS

    Figure 4 Mouse Anti-KIT Recombinant Antibody (PABL-642) in ELISA

    Mouse Anti-KIT Recombinant Antibody (clone 79D) (CAT# PABL-642)
    Application: WB, FuncS

    Figure 1 Anti-Human RNF43 Recombinant Antibody (TAB-327CT) in SDS-PAGE

    Mouse Anti-RNF43 Recombinant Antibody (TAB-327CT) (CAT# TAB-327CT)
    Application: WB, ELISA, FC, IHC, IP

    Figure 1 Anti-Human SLC1A5 Antibody (TAB-1010CLV) in FC

    Anti-Human SLC1A5 Recombinant Antibody (TAB-1010CLV) (CAT# TAB-1010CLV)
    Application: FC, ADCC, CDC

    Figure 2 Anti-SARS-CoV S Recombinant Antibody (MRO-654LC) in HPLC

    Mouse Anti-SARS-CoV S Recombinant Antibody (MRO-654LC) (CAT# MRO-654LC)
    Application: ELISA

    Figure 2 Anti-Human F8 Antibody in HPLC

    Recombinant Human Anti-F8 Antibody (BO2C11) (CAT# PABX-058)
    Application: WB, ELISA, FuncS, Inhib, PK, IP, SPR

    Figure 3 Anti-DPP4 Recombinant Antibody (HPAB-0215-YC) in ELISA

    Human Anti-DPP4 Recombinant Antibody (HPAB-0215-YC) (CAT# HPAB-0215-YC)
    Application: ELISA, Inhib, FuncS

    Figure 1 Mouse Anti-ROR1 Recombinant Antibody (HPAB-0308-CN) in SDS-PAGE

    Mouse Anti-ROR1 Recombinant Antibody (HPAB-0308-CN) (CAT# HPAB-0308-CN)
    Application: ELISA, FC

    Figure 4 Mouse Anti-PSCA Recombinant Antibody (HPAB-0287CQ) in WB

    Mouse Anti-PSCA Recombinant Antibody (clone mAb 8D11) (CAT# HPAB-0287CQ)
    Application: FC, IHC, Cyt, FuncS

    Figure 2 Human Anti-FRβ Recombinant Antibody (m909) (HPAB-0792-FY) in ELISA.

    Human Anti-FRβ Recombinant Antibody (HPAB-0792-FY) (CAT# HPAB-0792-FY)
    Application: ELISA

    Figure 2 Human Anti-HLA-B27 Recombinant Antibody (clone HD5) (HPAB-J0121-YC) in SDS-PAGE

    Human Anti-HLA-B27 Recombinant Antibody (clone HD5) (CAT# HPAB-J0121-YC)
    Application: ELISA, Block, WB, FC, IP

    Figure 3 Anti-TPO Recombinant Antibody (FAMAB-0014JF) in DB

    Human Anti-TPO Recombinant Antibody (clone B8) (CAT# FAMAB-0014JF)
    Application: WB, ELISA, IHC

    Figure 3 Human Anti-IL21R Recombinant Antibody (FAMAB-1203CQ) in DB

    Human Anti-IL21R Recombinant Antibody (clone ATR-107) (CAT# FAMAB-1203CQ)
    Application: Inhib, FC, WB

    Figure 4 Human Anti-PEG Recombinant Antibody (FAMAB-1525CQ) in ELISA

    Human Anti-PEG Recombinant Antibody (clone E11) (CAT# FAMAB-1525CQ)
    Application: WB, ELISA, FC

    Figure 3 Mouse Anti-Fibrin β chain Antibody (MOB-195YJL) in DB

    Mouse Anti-Fibrin β chain Recombinant Antibody (MOB-195YJL) (CAT# MOB-195YJL)
    Application: ELISA

    For Research Use Only. Not For Clinical Use.

    Send Inquiry

    This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

    Go to compare

    Go to compare