Rcombinant Anti-Human YAP1 Antibody. (CAT#: MOB-0305MC)
Recombinant Mouse Antibody specifically binds to Human YAP1.
Specific Inquiry
Specifications
- Immunogen
- YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
- Host Species
- Mouse
- Specificity
- YAP1 - Yes-associated protein 1, 65kDa
- Species Reactivity
- Human, Mouse
- Clone
- 3G23
Product Property
- Purity
- IgG purified
- Format
- Liquid
- Buffer
- Phosphate Buffered Saline, pH 7.4
- Preservative
- No Preservative
- Storage
- Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.
Applications
- Application Notes
- Western Blot 1:500
ELISA 1:100-1:2000
Immunocytochemistry/Immunofluorescence 30 ug/ml
Immunohistochemistry 1:10-1:500
Immunohistochemistry-Paraffin 3 ug/ml
Sandwich ELISA 1:100-1:2000
Target
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "YAP1"
Mouse Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-0306MC | Rabbit Anti-Phospho-YAP (Ser127) Antibody | WB |
Recombinant Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-2255CT | Recombinant Mouse anti-Human YAP1 Monoclonal antibody (EML1074) | IHC-P, WB | |
| MRO-1607-CN | Rabbit Anti-YAP1 Recombinant Antibody (clone CBACN-585) | WB, IF, IHC, IP, FC | Rabbit IgG |
| MRO-2393-CN | Rabbit Anti-YAP1 Recombinant Antibody (clone CBACN-678) | WB, IHC | Rabbit IgG |
| ZG-0623U | Rabbit Anti-Phospho-YAP1 (S127) Recombinant Antibody (clone 3F3) | ELISA, WB, IHC | Rabbit IgG |
| VS3-QX1256 | Mouse Anti-YAP1 Recombinant Antibody (clone 1A12) | WB, IHC, ICC, FC, ELISA | Mouse IgG1 |
Rabbit Monoclonal Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-3899 | Rabbit Anti-YAP1 Recombinant Antibody (clone DS3899AB) | IHC-P, WB | Rabbit IgG |
| MOR-0048-FY | Rabbit Anti-YAP1 Recombinant Antibody (clone AFY0019) | ICC, IHC-P, WB | Rabbit IgG |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for MOB-0305MC. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.