Mouse Anti-MUC16 Recombinant Antibody (HPAB-0122LY)

CAT#: HPAB-0122LY

This product is a recombinant Mouse IgM antibody that recognizes MUC16. The antibody was purified by affinity chromatography. This MUC16-directed monoclonal antibody was isolated by ELISA-based screening using both the individual peptides and recombinant GST-ΔMUC16c114 protein followed by sequential subcloning for single-cell clones. This antibody was characterized for utility in immunohistochemistry using OVCAR3 cell lines. The epitope of this antibody is KSYFSDCQVSTFRSVPNRHHTGVDSLCNFSPL.

Gene Expression
Figure 1 Cervix Figure 2 RNA cell line category: Group enriched (A-431, HeLa)

Specifications

  • Host Species
  • Mouse
  • Derivation
  • Mouse
  • Type
  • Mouse IgG
  • Specificity
  • Human MUC16
  • Species Reactivity
  • Human
  • Applications
  • WB, ELISA, FC, IHC

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • Mucin 16, Cell Surface Associated; Ovarian Cancer-Related Tumor Marker CA125; Ovarian Carcinoma Antigen CA125; CA125; CA125 Ovarian Cancer Antigen; Mucin-16; CA-125; MUC-16;
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-0122LY. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

Protocol & Troubleshooting

We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.

See other products for "MUC16"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
MOR-2321 Hi-Affi™ Recombinant Rabbit Anti-MUC16 Monoclonal Antibody (DS2321AB) ICC, IHC-P, WB IgG
CAT Product Name Application Type
AFC-TAB-114 Afuco™ Anti-MUC16 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-114) IP, IF, FuncS, FC, Neut, ELISA ADCC enhanced antibody
AFC-TAB-H63 Afuco™ Anti-MUC16 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H63) IF, IP, Neut, FuncS, ELISA, FC ADCC enhanced antibody
CAT Product Name Application Type
VS-0924-YC140 Human Anti-MUC16 Recombinant Antibody Hexamer (VS-0924-YC140), CDC Enhanced DB, WB, IP, ELISA, FC, CDC Antibody hexamer
CAT Product Name Application Type
VS-0425-FY70 Mouse Anti-MUC16 (clone VK-8) scFv-Fc Chimera IF, FC Mouse IgG1, scFv-Fc
CAT Product Name Application Type
VS-0425-YC337 Recombinant Anti-MUC16 Vesicular Antibody, EV Displayed (VS-0425-YC337) ELISA, FC, Neut, Cell-uptake
CAT Product Name Application Type
VS-0525-XY4578 Anti-MUC16 Immunohistochemistry Kit IHC
CAT Product Name Application Type
VS-0525-YC133 Recombinant Anti-MUC16 Biparatopic Antibody, Tandem scFv ELISA, FC, IHC, WB Tandem scFv
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare

Merry Christmas & Happy New Year
Happy Thanksgiving close ad