This product is a recombinant Mouse IgM antibody that recognizes MUC16. The antibody was purified by affinity chromatography. This MUC16-directed monoclonal antibody was isolated by ELISA-based screening using both the individual peptides and recombinant GST-ΔMUC16c114 protein followed by sequential subcloning for single-cell clones. This antibody was characterized for utility in immunohistochemistry using OVCAR3 cell lines. The epitope of this antibody is KSYFSDCQVSTFRSVPNRHHTGVDSLCNFSPL.
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Download resources about recombinant antibody development and antibody engineering to boost your research.
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-114 | Anti-Human CA-125 Recombinant Antibody (Abagovomab) | IP, IF, FuncS, FC, Neut, ELISA, ICC | IgG1 - kappa |
TAB-1401CL | Anti-Human MUC16 Recombinant Antibody (OC125) | IF, IHC, IP, FC | |
TAB-1402CL | Anti-Human MUC16 Recombinant Antibody (VK-8) | IF, FC | |
TAB-1401CL-F(E) | Anti-Human MUC16 Recombinant Antibody Fab Fragment (OC125) | IF, IHC, IP, FC | |
TAB-1402CL-F(E) | Anti-Human MUC16 Recombinant Antibody Fab Fragment (VK-8) | IF, FC |
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-0339CL | Human Anti-MUC16 Recombinant Antibody (TAB-0339CL) | DB, WB, IP, ELISA, FC, CDC | Humanized Antibody |
TAB-1397CL | Human Anti-MUC16 Recombinant Antibody (TAB-1397CL) | FuncS | Humanized IgG |
TAB-1399CL | Human Anti-MUC16 Recombinant Antibody (TAB-1399CL) | FuncS | Humanized IgG |
TAB-1397CL-F(E) | Human Anti-MUC16 Recombinant Antibody; Fab Fragment (TAB-1397CL-F(E)) | FuncS | Humanized Fab |
TAB-1399CL-F(E) | Human Anti-MUC16 Recombinant Antibody; Fab Fragment (TAB-1399CL-F(E)) | FuncS | Humanized Fab |
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-1398CL | Human Anti-MUC16 Recombinant Antibody (TAB-1398CL) | FuncS | Chimeric (mouse/human) IgG |
TAB-1400CL | Human Anti-MUC16 Recombinant Antibody (TAB-1400CL) | FuncS | Chimeric (mouse/human) IgG |
TAB-1398CL-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (TAB-1398CL-S(P)) | FuncS | Mouse scFv |
TAB-1400CL-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (TAB-1400CL-S(P)) | FuncS | Mouse scFv |
TAB-1398CL-F(E) | Human Anti-MUC16 Recombinant Antibody; Fab Fragment (TAB-1398CL-F(E)) | FuncS | Chimeric (mouse/human) Fab |
CAT | Product Name | Application | Type |
---|---|---|---|
MOR-2321 | Hi-Affi™ Recombinant Rabbit Anti-MUC16 Monoclonal Antibody (DS2321AB) | ICC, IHC-P, WB | IgG |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0310-YC-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-0310-YC-S(P)) | ELISA, FC, IHC, FuncS | Mouse scFv |
HPAB-1114LY-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-1114LY-S(P)) | ELISA | Mouse scfv |
HPAB-0120LY-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-0120LY-S(P)) | WB, ELISA, FC, IHC | Mouse scfv |
HPAB-0121LY-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-0121LY-S(P)) | WB, ELISA, FC, IHC | Mouse scfv |
HPAB-0122LY-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-0122LY-S(P)) | WB, ELISA, FC, IHC | Mouse scfv |
CAT | Product Name | Application | Type |
---|---|---|---|
FAMAB-0043-YC-F(E) | Mouse Anti-MUC16 Recombinant Antibody (clone 196-14); Fab Fragment | FuncS | Mouse Fab |
FAMAB-0044-YC-F(E) | Human Anti-MUC16 Recombinant Antibody (clone ch196-14); Fab Fragment | FuncS | Human Fab |
HPAB-0120LY-F(E) | Mouse Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-0120LY-F(E)) | WB, ELISA, FC, IHC | Mouse Fab |
HPAB-0121LY-F(E) | Mouse Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-0121LY-F(E)) | WB, ELISA, FC, IHC | Mouse Fab |
HPAB-N0185-YC-F(E) | Human Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-N0185-YC-F(E)) | FuncS | Humanized Fab |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-1114LY | Mouse Anti-MUC16 Recombinant Antibody (HPAB-1114LY) | ELISA | Mouse IgG |
HPAB-1115LY | Mouse Anti-MUC16 Recombinant Antibody (HPAB-1115LY) | ELISA | Mouse IgG |
HPAB-1116LY | Mouse Anti-MUC16 Recombinant Antibody (HPAB-1116LY) | ELISA | Mouse IgG |
HPAB-1117LY | Mouse Anti-MUC16 Recombinant Antibody (HPAB-1117LY) | ELISA | Mouse IgG |
MRO-1040-CN | Recombinant Rabbit Anti-MUC16 Monoclonal Antibody (CBACN-386) | WB, IF, FC | Rabbit IgG |
CAT | Product Name | Application | Type |
---|---|---|---|
AFC-TAB-114 | Afuco™ Anti-MUC16 ADCC Recombinant Antibody (Abagovomab), ADCC Enhanced | IP, IF, FuncS, FC, Neut, ELISA | ADCC enhanced antibody |
AFC-TAB-H63 | Afuco™ Anti-MUC16 ADCC Recombinant Antibody (Sofituzumab), ADCC Enhanced | IF, IP, Neut, FuncS, ELISA, FC | ADCC enhanced antibody |
There are currently no Customer reviews or questions for HPAB-0122LY. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.