Mouse Anti-MUC16 Recombinant Antibody (HPAB-0122LY)
CAT#: HPAB-0122LY
This product is a recombinant Mouse IgM antibody that recognizes MUC16. The antibody was purified by affinity chromatography. This MUC16-directed monoclonal antibody was isolated by ELISA-based screening using both the individual peptides and recombinant GST-ΔMUC16c114 protein followed by sequential subcloning for single-cell clones. This antibody was characterized for utility in immunohistochemistry using OVCAR3 cell lines. The epitope of this antibody is KSYFSDCQVSTFRSVPNRHHTGVDSLCNFSPL.
Specifications
- Host Species
- Mouse
- Derivation
- Mouse
- Type
- Mouse IgG
- Specificity
- Human MUC16
- Species Reactivity
- Human
- Applications
- WB, ELISA, FC, IHC
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
Customer Review
There are currently no Customer reviews or questions for HPAB-0122LY. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Protocol & Troubleshooting
We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.
See other products for "MUC16"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1301z | Mouse Anti-MUC16 Recombinant Antibody (clone 21C12) | WB, ELISA, IHC | Mouse IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-H63 | Humanized Anti-MUC16 Recombinant V-kappa Antibody (TAB-H63) | IF, IP, Neut, FuncS, ELISA, FC, WB | Humanized IgG1, κ |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-114 | Anti-Human CA-125 Recombinant Antibody (TAB-114) | IP, IF, FuncS, FC, Neut, ELISA, ICC | IgG1 - kappa |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-043 | Anti-Human MUC16 Recombinant Antibody F(ab')2 Fragment (TAB-043) | ELISA, FC, IP, FuncS, IF, Neut, IHC | F(ab')2 - G1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-0339CL | Human Anti-MUC16 Recombinant Antibody (TAB-0339CL) | DB, WB, IP, ELISA, FC, CDC | Humanized Antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1397CL | Human Anti-MUC16 Recombinant Antibody (TAB-1397CL) | FuncS | Humanized IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1398CL | Human Anti-MUC16 Recombinant Antibody (TAB-1398CL) | FuncS | Chimeric (mouse/human) IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1399CL | Human Anti-MUC16 Recombinant Antibody (TAB-1399CL) | FuncS | Humanized IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1400CL | Human Anti-MUC16 Recombinant Antibody (TAB-1400CL) | FuncS | Chimeric (mouse/human) IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1401CL | Anti-Human MUC16 Recombinant Antibody (OC125) | IF, IHC, IP, FC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1402CL | Anti-Human MUC16 Recombinant Antibody (VK-8) | IF, FC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-0339CL-S(P) | Human Anti-MUC16 Recombinant Antibody; scFv Fragment (TAB-0339CL-S(P)) | DB, WB, IP, ELISA, FC | Humanized scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1398CL-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (TAB-1398CL-S(P)) | FuncS | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1400CL-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (TAB-1400CL-S(P)) | FuncS | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1401CL-S(P) | Anti-Human MUC16 Recombinant Antibody scFv Fragment (OC125) | IF, IHC, IP, FC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1398CL-F(E) | Human Anti-MUC16 Recombinant Antibody; Fab Fragment (TAB-1398CL-F(E)) | FuncS | Chimeric (mouse/human) Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-0268MZ | Recombinant Mouse Anti-Human Mucin 16 Cell Surface Associated Antibody (clone N12) | IHC | Mouse antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-2321 | Hi-Affi™ Recombinant Rabbit Anti-MUC16 Monoclonal Antibody (DS2321AB) | ICC, IHC-P, WB | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0310-YC | Mouse Anti-MUC16 Recombinant Antibody (HPAB-0310-YC) | ELISA, FC, IHC, FuncS | Mouse IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0310-YC-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-0310-YC-S(P)) | ELISA, FC, IHC, FuncS | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0310-YC-F(E) | Mouse Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-0310-YC-F(E)) | ELISA, FC, IHC, FuncS | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0043YC | Mouse Anti-MUC16 Recombinant Antibody (clone 196-14) | FuncS | Mouse IgG1, κ |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0044YC | Human Anti-MUC16 Recombinant Antibody (clone ch196-14) | FuncS | Chimeric (mouse/human) IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0043-YC-S(P) | Mouse Anti-MUC16 Recombinant Antibody (clone 196-14); scFv Fragment | FuncS | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0044-YC-S(P) | Mouse Anti-MUC16 Recombinant Antibody (clone ch196-14); scFv Fragment | FuncS | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0043-YC-F(E) | Mouse Anti-MUC16 Recombinant Antibody (clone 196-14); Fab Fragment | FuncS | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0044-YC-F(E) | Human Anti-MUC16 Recombinant Antibody (clone ch196-14); Fab Fragment | FuncS | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-1114LY-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-1114LY-S(P)) | ELISA | Mouse scfv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-1115LY-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-1115LY-S(P)) | ELISA | Mouse scfv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-1114LY-F(E) | Mouse Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-1114LY-F(E)) | ELISA | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-1115LY-F(E) | Mouse Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-1115LY-F(E)) | ELISA | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AFC-TAB-114 | Afuco™ Anti-MUC16 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-114) | IP, IF, FuncS, FC, Neut, ELISA | ADCC enhanced antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AFC-TAB-H63 | Afuco™ Anti-MUC16 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H63) | IF, IP, Neut, FuncS, ELISA, FC | ADCC enhanced antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0924-YC140 | Human Anti-MUC16 Recombinant Antibody Hexamer (VS-0924-YC140), CDC Enhanced | DB, WB, IP, ELISA, FC, CDC | Antibody hexamer |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-FY70 | Mouse Anti-MUC16 (clone VK-8) scFv-Fc Chimera | IF, FC | Mouse IgG1, scFv-Fc |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-YC337 | Recombinant Anti-MUC16 Vesicular Antibody, EV Displayed (VS-0425-YC337) | ELISA, FC, Neut, Cell-uptake |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY4578 | Anti-MUC16 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-YC133 | Recombinant Anti-MUC16 Biparatopic Antibody, Tandem scFv | ELISA, FC, IHC, WB | Tandem scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0825-YC262 | SmartAb™ Recombinant Anti-MUC16 pH-dependent Antibody (VS-0825-YC262) | IF, IP, Neut, ELISA, FC, WB | Human IgG1 kappa |
Popular Products

Application: WB, IF, IP, Neut, FuncS, ELISA, FC

Application: FuncS, IF, Neut, ELISA, FC, IP, ICC

Application: WB, ELISA, IP, FC, FuncS, Neut, IF

Application: FC, IP, ELISA, Neut, FuncS, IF, ICC

Application: ELISA, IP, FC, FuncS, Neut, IF, ICC

Application: WB, ELISA, IP, FC, FuncS, Neut, IF

Application: FuncS, IF, Neut, ELISA, FC, IP, IHC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: FC, IP, ELISA, Neut, FuncS, IF, ICC

Application: Inhib, Cyt

Application: Neut, ELISA, IF, IP, FuncS, FC, WB

Application: ELISA, WB, BLI, SPR
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.





-2.png)





