Recombinant Mouse Anti-HIV-1 Antibody (83.1)

CAT#: PABX-084

Anti-HIV-1 antibody is a Mouse antibody of IgG1 λ class that binds to an HIV-1.

Specifications

  • Immunogen
  • cyclic peptide RP70 (INC*TRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHC*NIS with a disulfide bond between the two C* residues)
  • Host Species
  • Mouse
  • Derivation
  • Mouse
  • Type
  • IgG
  • Specificity
  • Tested positive against native HIV-1
  • Species Reactivity
  • Human immunodeficiency virus 1
  • Clone
  • 83. 1
  • Applications
  • Can be useful in applications such as: Western blot; Enzyme-linked Immunosorbent Assay; Functional Study

Product Property

  • Purity
  • >95% by SDS-PAGE and HPLC analysis
  • Storage
  • Store the antibody (in aliquots) at -20°C. Avoid repeated freezing and thawing of samples.

Target

  • Alternative Names
  • HIV-1; human immunodeficiency virus
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for PABX-084. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "Clone 83. 1"

See other products for "HIV-1"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
NAB-1889-sdAb Recombinant Anti-HIV-1 VHH Single Domain Antibody WB, ICC, ChiP, FA, ELISA Llama VHH
PNBL-038 Recombinant Anti-HIV-1 C186 gp120 VHH Single Domain Antibody (PNBL-038) WB, FuncS Llama VHH
CAT Product Name Application Type
TAB-068 Anti-HIV-1 Recombinant Antibody (TAB-068) WB, ELISA, IP, FC, FuncS, Neut, IF IgG1 - kappa
PABX-094-S (P) Recombinant Human Anti-HIV-1 Antibody scFv Fragment (Fab4025) WB, ELISA, FuncS scFv
PABX-099-S (P) Recombinant Human Anti-HIV-1 Antibody scFv Fragment FC, FuncS scFv
CAT Product Name Application Type
AGTO-G037E Anti-HIV-1 immunotoxin 3B3 (scFv)-PE Cytotoxicity assay, Function study
AGTO-G037D Anti-HIV-1 immunotoxin 3B3 (scFv)-DT Cytotoxicity assay, Function study
CAT Product Name Application Type
PABX-093-S (P) Recombinant Mouse Anti-HIV-1 Antibody scFv Fragment (Fab28) WB, ELISA, FuncS scFv
CAT Product Name Application Type
MOR-4221 Rabbit Anti-HIV-1 Recombinant Antibody (clone SI300DS) ELISA, ICC, IF, FC Rabbit IgG
CAT Product Name Application Type
AFC-TAB-068 Afuco™ Anti-HIV-1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-068) ELISA, IP, FC, FuncS, Neut ADCC enhanced antibody
CAT Product Name Application Type
HPAB-1988-FY Human Anti-HIV-1 Recombinant Antibody (clone 2G9) FC, ELISA, Neut Human IgM
CAT Product Name Application Type
VS-0125-FY67 Human Anti-HIV-1 (clone 3D6) scFv-Fc Chimera Neut Human IgG1, scFv-Fc
VS-0125-FY68 Human Anti-HIV-1 (clone 2F5) scFv-Fc Chimera Neut Human IgG1, scFv-Fc
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare

Merry Christmas & Happy New Year
Happy Thanksgiving close ad