Recombinant Mouse Anti-HIV-1 Antibody (83.1)
CAT#: PABX-084
Anti-HIV-1 antibody is a Mouse antibody of IgG1 λ class that binds to an HIV-1.
Specifications
- Immunogen
- cyclic peptide RP70 (INC*TRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHC*NIS with a disulfide bond between the two C* residues)
- Host Species
- Mouse
- Derivation
- Mouse
- Type
- IgG
- Specificity
- Tested positive against native HIV-1
- Species Reactivity
- Human immunodeficiency virus 1
- Clone
- 83. 1
- Applications
- Can be useful in applications such as: Western blot; Enzyme-linked Immunosorbent Assay; Functional Study
Product Property
- Purity
- >95% by SDS-PAGE and HPLC analysis
- Storage
- Store the antibody (in aliquots) at -20°C. Avoid repeated freezing and thawing of samples.
Target
- Alternative Names
- HIV-1; human immunodeficiency virus
Customer Review
There are currently no Customer reviews or questions for PABX-084. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "Clone 83. 1"
- CAT
- Product Name
See other products for "HIV-1"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NAB-1889-sdAb | Recombinant Anti-HIV-1 VHH Single Domain Antibody | WB, ICC, ChiP, FA, ELISA | Llama VHH |
| PNBL-038 | Recombinant Anti-HIV-1 C186 gp120 VHH Single Domain Antibody (PNBL-038) | WB, FuncS | Llama VHH |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-068 | Anti-HIV-1 Recombinant Antibody (TAB-068) | WB, ELISA, IP, FC, FuncS, Neut, IF | IgG1 - kappa |
| PABX-094-S (P) | Recombinant Human Anti-HIV-1 Antibody scFv Fragment (Fab4025) | WB, ELISA, FuncS | scFv |
| PABX-099-S (P) | Recombinant Human Anti-HIV-1 Antibody scFv Fragment | FC, FuncS | scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AGTO-G037E | Anti-HIV-1 immunotoxin 3B3 (scFv)-PE | Cytotoxicity assay, Function study | |
| AGTO-G037D | Anti-HIV-1 immunotoxin 3B3 (scFv)-DT | Cytotoxicity assay, Function study |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| PABL-140 | Human Anti-HIV-1 Recombinant Antibody (clone VRC26.25) | WB, ELISA, Neut, FuncS | Human IgG1 |
| HPAB-AP363-YC | Human Anti-HIV-1 Recombinant Antibody (clone A2) | FuncS, FC | Human IgG |
| VS-0423-XY8 | Mouse Anti-HIV-1 Recombinant Antibody (clone CP503) | ELISA | Mouse IgG |
| VS-0423-XY9 | Mouse Anti-HIV-1 Recombinant Antibody (clone CP506) | ELISA | Mouse IgG |
| VS-0423-XY10 | Mouse Anti-HIV-1 Recombinant Antibody (clone CP507) | ELISA | Mouse IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| PSBL-140 | Human Anti-HIV-1 Recombinant Antibody (clone VRC26.25); scFv Fragment | WB, ELISA, Neut, FuncS | Human scFv |
| FAMAB-0176CQ-S(P) | Mouse Anti-HIV-1 Recombinant Antibody (clone KEL10); scFv Fragment | ELISA, Neut | Mouse scFv |
| HPAB-0158-YJ-S(P) | Mouse Anti-HIV-1 Recombinant Antibody; scFv Fragment (HPAB-0158-YJ-S(P)) | ELISA, Neut, Inhib | Mouse scFv |
| HPAB-AP363-YC-S(P) | Human Anti-HIV-1 Recombinant Antibody (clone A2); scFv Fragment | ELISA, Neut | Human scFv |
| HPAB-1988-FY-S(P) | Human Anti-HIV-1 Recombinant Antibody (clone 2G9); scFv Fragment | FC, ELISA | Human scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| PFBL-140 | Human Anti-HIV-1 Recombinant Antibody (clone VRC26.25); Fab Fragment | WB, ELISA, Neut, FuncS | Human Fab |
| FAMAB-0176CQ-F(E) | Mouse Anti-HIV-1 Recombinant Antibody (clone KEL10); Fab Fragment | ELISA, Neut | Mouse Fab |
| HPAB-0158-YJ-F(E) | Human Anti-HIV-1 Recombinant Antibody; Fab Fragment (HPAB-0158-YJ-F(E)) | ELISA, Neut, Inhib | Human Fab |
| HPAB-AP363-YC-F(E) | Human Anti-HIV-1 Recombinant Antibody (clone A2); Fab Fragment | ELISA, Neut | Human Fab |
| HPAB-1988-FY-F(E) | Human Anti-HIV-1 Recombinant Antibody (clone 2G9); Fab Fragment | FC, ELISA | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| PABX-008-S (P) | Recombinant Mouse Anti-HIV-1 Antibody scFv Fragment | WB, IHC, IF, FuncS | scFv |
| PABX-095-S (P) | Recombinant Mouse Anti-HIV-1 Antibody scFv Fragment (Fab59.1) | Neut, ELISA, FuncS | scFv |
| PABX-087-F (E) | Recombinant Human Anti-HIV-1 Antibody Fab Fragment (2G12) | WB, ELISA, FuncS | Fab |
| PABX-088-F (E) | Recombinant Human Anti-HIV-1 Antibody Fab Fragment (447-52D) | WB, ELISA, IF, FuncS | Fab |
| PABX-087-F(E) | Human Anti-HIV-1 Recombinant Antibody; Fab Fragment (PABX-087-F(E)) | WB, ELISA, FuncS | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| PABX-084-S (P) | Recombinant Mouse Anti-HIV-1 Antibody scFv Fragment (83.1) | WB, ELISA, FuncS | scFv |
| PABX-087-S (P) | Recombinant Human Anti-HIV-1 Antibody scFv Fragment (2G12) | WB, ELISA, FuncS | scFv |
| PABX-088-S (P) | Recombinant Human Anti-HIV-1 Antibody scFv Fragment (447-52D) | WB, ELISA, IF, FuncS | scFv |
| PABX-089-S (P) | Recombinant Mouse Anti-HIV-1 Antibody scFv Fragment (A10F9) | Neut, FuncS | scFv |
| PABX-090-S (P) | Recombinant Human Anti-HIV-1 Antibody scFv Fragment (CH04H/CH02L) | Neut, FuncS | scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| PABX-093-S (P) | Recombinant Mouse Anti-HIV-1 Antibody scFv Fragment (Fab28) | WB, ELISA, FuncS | scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MHC-LC1376 | PE-A*02:01/HIV-1 (SLFNTVATL) MHC Tetramer | FCM | |
| MHC-LC1377 | APC-A*02:01/HIV-1 (SLFNTVATL) MHC Tetramer | FCM | |
| MHC-LC1378 | BV421-A*02:01/HIV-1 (SLFNTVATL) MHC Tetramer | FCM |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-4221 | Rabbit Anti-HIV-1 Recombinant Antibody (clone SI300DS) | ELISA, ICC, IF, FC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AFC-TAB-068 | Afuco™ Anti-HIV-1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-068) | ELISA, IP, FC, FuncS, Neut | ADCC enhanced antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-1988-FY | Human Anti-HIV-1 Recombinant Antibody (clone 2G9) | FC, ELISA, Neut | Human IgM |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0125-FY67 | Human Anti-HIV-1 (clone 3D6) scFv-Fc Chimera | Neut | Human IgG1, scFv-Fc |
| VS-0125-FY68 | Human Anti-HIV-1 (clone 2F5) scFv-Fc Chimera | Neut | Human IgG1, scFv-Fc |
Popular Products

Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

Application: ELISA, IP, FC, FuncS, Neut, IF, IHC

Application: WB, ELISA, FC, IP, FuncS, IF, Neut

Application: IF, IP, Neut, FuncS, ELISA, FC, WB

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: ELISA, SPR, Inhib, FuncS

Application: WB, ELISA, Neut, FuncS

Application: ELISA, FC, Inhib

Application: FC, IHC, Cyt, FuncS
-4.jpg)
Application: FC

Application: ELISA, FuncS, Neut, IF, WB, EM, Inhib, IHC

Application: ELISA

Application: IF, ICC, WB, IHC-P, IP
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.











