
Recombinant Mouse Anti-HIV-1 Antibody (83.1) (PABX-084)

Anti-HIV-1 antibody is a Mouse antibody of IgG1 λ class that binds to an HIV-1.      

cyclic peptide RP70 (INC*TRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHC*NIS with a disulfide bond between the two C* residues)
Tested positive against native HIV-1
Species Reactivity
Human immunodeficiency virus 1
83. 1
Can be useful in applications such as: Western blot; Enzyme-linked Immunosorbent Assay; Functional Study
Alternative Names
HIV-1; human immunodeficiency virus

For lab research use only, not for diagnostic, therapeutic or any in vivo human use.

Our customer service representatives are available 24 hours a day, from Monday to Sunday. Contact Us
Send Inquiry Now!
* Phone:
* E-mail Address:
* Service & Products Interested:
Project Description:
* Verification Code:
Please input "biolabs"(case insensitive) as verification code.
Contact Us to Order
Tel: 1-631-381-2994
Fax: 1-631-207-8356

45-1 Ramsey Road, Shirley, NY 11967, USA     Tel: 1-631-381-2994    Fax: 1-631-207-8356    Email:
Terms of Service-Privacy Policy     © 2007 - 2018 Creative-Biolabs All Rights Reserved