Recombinant Mouse Anti-HIV-1 Antibody (83.1) (CAT#: PABX-084)
Anti-HIV-1 antibody is a Mouse antibody of IgG1 λ class that binds to an HIV-1.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.
Specifications
- Immunogen
- cyclic peptide RP70 (INC*TRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHC*NIS with a disulfide bond between the two C* residues)
- Host Species
- Mouse
- Derivation
- Mouse
- Type
- IgG
- Specificity
- Tested positive against native HIV-1
- Species Reactivity
- Human immunodeficiency virus 1
- Clone
- 83. 1
- Applications
- Can be useful in applications such as: Western blot; Enzyme-linked Immunosorbent Assay; Functional Study
Product Property
- Purity
- >95% by SDS-PAGE and HPLC analysis
- Storage
- Store the antibody (in aliquots) at -20°C. Avoid repeated freezing and thawing of samples.
Target
- Alternative Names
- HIV-1; human immunodeficiency virus
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "Clone 83. 1"
See other products for "HIV-1"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
NAB-1889-sdAb | Recombinant Anti-HIV-1 VHH Single Domain Antibody | WB, ICC, ChiP, FA, ELISA | Llama VHH |
PNBL-038 | Recombinant Anti-HIV-1 C186 gp120 VHH Single Domain Antibody (PNBL-038) | WB, FuncS | Llama VHH |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for PABX-084. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: WB, FuncS, IF, Neut, ELISA, FC, IP
Application: ELISA, IP, FC, FuncS, Neut, IF, ICC
Application: FC, IP, ELISA, Neut, FuncS, IF, IHC
Application: Block, Cyt, FuncS, Inhib
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: ELISA, IHC, FC, IP, IF, FuncS
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.