Recombinant Mouse Anti-HIV-1 Antibody scFv Fragment (83.1) (CAT#: PABX-084-S (P))

Anti-HIV-1 antibody (83.1) is a mouse of scFv class that binds to an HIV-1.


Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Datasheet
  • MSDS
  • COA

Specifications

  • Immunogen
  • cyclic peptide RP70 (INC*TRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHC*NIS with a disulfide bond between the two C* residues)
  • Host Species
  • Mouse
  • Derivation
  • Mouse
  • Type
  • scFv
  • Specificity
  • Tested positive against native Horse Cytc
  • Species Reactivity
  • Human immunodeficiency virus 1
  • Clone
  • 83. 1
  • Applications
  • Can be useful in applications such as: Western blot; Enzyme-linked Immunosorbent Assay; Functional Study

Product Property

  • Purity
  • >95% by SDS-PAGE and HPLC analysis
  • Storage
  • Store the antibody (in aliquots) at -20°C. Avoid repeated freezing and thawing of samples.

Target

  • Alternative Names
  • HIV-1; human immunodeficiency virus

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "Clone 83. 1"

See other products for "HIV-1"

Single-domain Antibody

CAT Product Name Application Type
NAB-1889-sdAb Recombinant Anti-HIV-1 VHH Single Domain Antibody WB, ICC, ChiP, FA, ELISA Llama VHH
PNBL-038 Recombinant Anti-HIV-1 C186 gp120 VHH Single Domain Antibody (PNBL-038) WB, FuncS Llama VHH

Humanized Antibody

Immunotoxin

CAT Product Name Application Type
AGTO-G037E Anti-HIV-1 immunotoxin 3B3 (scFv)-PE Cytotoxicity assay, Function study
AGTO-G037D Anti-HIV-1 immunotoxin 3B3 (scFv)-DT Cytotoxicity assay, Function study

Recombinant Antibody

Chimeric Antibody

CAT Product Name Application Type
PABX-093-S (P) Recombinant Mouse Anti-HIV-1 Antibody scFv Fragment (Fab28) WB, ELISA, FuncS scFv

Rabbit Monoclonal Antibody

CAT Product Name Application Type
MOR-4221 Rabbit Anti-HIV-1 Recombinant Antibody (clone SI300DS) ELISA, ICC, IF, FC Rabbit IgG

ADCC Enhanced Antibody

CAT Product Name Application Type
AFC-TAB-068 Afuco™ Anti-HIV-1 ADCC Recombinant Antibody (Suvizumab), ADCC Enhanced ELISA, IP, FC, FuncS, Neut ADCC enhanced antibody

Customer Reviews and Q&As

Submit a review or a question
There are currently no Customer reviews or questions for PABX-084-S (P). Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0
Cart

    Go to compare