Recombinant Mouse Anti-HIV-1 Antibody scFv Fragment (83.1) (CAT#: PABX-084-S (P))

Anti-HIV-1 antibody (83.1) is a mouse of scFv class that binds to an HIV-1.

Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Formats:
  • Isotype Switching:
  • Fc Engineering:
  • Modalities:
  • Datasheet
  • MSDS
  • COA

Specifications

  • Immunogen
  • cyclic peptide RP70 (INC*TRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHC*NIS with a disulfide bond between the two C* residues)
  • Host Species
  • Mouse
  • Derivation
  • Mouse
  • Type
  • scFv
  • Specificity
  • Tested positive against native Horse Cytc
  • Species Reactivity
  • Human immunodeficiency virus 1
  • Clone
  • 83. 1
  • Applications
  • Can be useful in applications such as: Western blot; Enzyme-linked Immunosorbent Assay; Functional Study

Product Property

  • Purity
  • >95% by SDS-PAGE and HPLC analysis
  • Storage
  • Store the antibody (in aliquots) at -20°C. Avoid repeated freezing and thawing of samples.

Target

  • Alternative Names
  • HIV-1; human immunodeficiency virus

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "Clone 83. 1"

See other products for "HIV-1"

Select a product category from the dropdown menu below to view related products.
Please select product type
Single Domain Antibody Products Humanized Antibody Products Immunotoxin Products ScFv Antibody Products Fab Antibody Products IgG Antibody Products Mouse Antibody Products Chimeric Antibody Products Human Antibody Products MHC Tetramer Products for Virology Rabbit Monoclonal Antibody Products ADCC Enhanced Antibody Products IgM Antibody Products ScFv-Fc Chimera Products
CAT Product Name Application Type
NAB-1889-sdAb Recombinant Anti-HIV-1 VHH Single Domain Antibody WB, ICC, ChiP, FA, ELISA Llama VHH
PNBL-038 Recombinant Anti-HIV-1 C186 gp120 VHH Single Domain Antibody (PNBL-038) WB, FuncS Llama VHH

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for PABX-084-S (P). Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

  • 0
  • 0
Cart
    Go to compare

    Go to compare