Mouse Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-AP738-YC-F(E)) (CAT#: HPAB-AP738-YC-F(E))
This product is a recombinant mouse antibody Fab fragment that recognizes Mucin1. This monoclonal antibody was generated to MUC1 peptide (GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA) using standard hybridoma generation. It was screened for recognition of the MUC1 peptide by ELISA. The clone MIN-A2-1 Fab fragment was tested by FACS (fluorescence-activated cell sorting) for its ability to bind MUC1 on intact cells.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to plasma membrane.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/8855/1789_B9_13_cr596f381e20667_selected.jpg

(Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/1986/ihc_selected.jpg

(Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/8855/100_E7_1_blue_red_green.jpg

(Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/8855/101_E7_1_blue_red_green.jpg

(Glandular cells
Staining:High
Intensity: Strong
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/36/155175_A_2_1.jpg

(Endocrine cells
Staining:High
Intensity: Strong
Enterocytes
Staining:High
Intensity: Strong
Quantity: 75%-25%
Goblet cells
Staining:High
Intensity: Strong
Quantity:>75%)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/36/155175_A_9_3.jpg

(Collecting ducts
Staining:High
Intensity: Strong
Quantity:>75%
Distal tubules
Staining:High
Intensity: Strong
Quantity:>75%)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/36/155175_A_8_5.jpg

(Elongated or late spermatids
Staining:Medium
Intensity: Moderate
Quantity: 75%-25%)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/36/155175_A_6_6.jpg

(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/ENSG00000185499-MUC1
Specifications
- Immunogen
- GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA
- Host Species
- Mouse
- Type
- Mouse Fab
- Specificity
- Human MUC1
- Species Reactivity
- Human
- Applications
- ELISA
- Related Disease
- Cancer
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
- Alternative Names
- Mucin 1, Cell Surface Associated; Tumor-Associated Epithelial Membrane Antigen; Breast Carcinoma-Associated Antigen DF3; Peanut-Reactive Urinary Mucin; Polymorphic Epithelial Mucin; Carcinoma-Associated Mucin; Mucin 1, Transmembrane; Krebs Von Den Lungen-6; Cancer Antigen 15-3; Episialin; CA 15-3; H23AG; MUC-1; KL-6; PEMT; EMA; PUM; PEM
- Gene ID
- 4582
- UniProt ID
- P15941
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "MUC1"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
NAB-2049-VHH | Recombinant Anti-human MUC1 VHH Single Domain Antibody | WB, IP, ChiP, Neut, ELISA | Llama VHH |
HPAB-AP504-YC | Recombinant Camel Anti-MUC1 Single Domain Antibody (HPAB-AP504-YC) | FC | Camel VHH |
HPAB-AP505-YC | Recombinant Camel Anti-MUC1 Single Domain Antibody (HPAB-AP505-YC) | ELISA | Camel VHH |
HPAB-0736-YJ-VHH | Camelid Anti-MUC1 Recombinant Single Domain Antibody (HPAB-0736-YJ-VHH) | ELISA | Camelid VHH |
HPAB-0737-YJ-VHH | Camelid Anti-MUC1 Recombinant Single Domain Antibody (HPAB-0737-YJ-VHH) | ELISA | Camelid VHH |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for HPAB-AP738-YC-F(E). Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: FC, Cyt, Stim, PP, Agonist
Application: FC, IP, ELISA, Neut, FuncS, IF, IHC
Application: IF, IP, Neut, FuncS, ELISA, FC, WB
Application: FuncS, IF, Neut, ELISA, FC, IP, IHC
Application: WB, FuncS, IF, Neut, ELISA, FC, IP
Application: FC, IB, Block, Inhib, FuncS, ELISA, FACS, IP, IF
Application: WB, ELISA, FC, IHC, IP
Application: Neut, FC
Application: ELISA, IHC, FC, IP, IF, Inhib
Application: ELISA
Application: ELISA, Cyt, PP, Inhib
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.