Mouse Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-AP738-YC-F(E)) (CAT#: HPAB-AP738-YC-F(E))

This product is a recombinant mouse antibody Fab fragment that recognizes Mucin1. This monoclonal antibody was generated to MUC1 peptide (GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA) using standard hybridoma generation. It was screened for recognition of the MUC1 peptide by ELISA. The clone MIN-A2-1 Fab fragment was tested by FACS (fluorescence-activated cell sorting) for its ability to bind MUC1 on intact cells.

Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location and Protein Expression
Normal Tissue
RNA Expression


  • Immunogen
  • Host Species
  • Mouse
  • Type
  • Mouse Fab
  • Specificity
  • Human MUC1
  • Species Reactivity
  • Human
  • Applications
  • Related Disease
  • Cancer

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.


  • Alternative Names
  • Mucin 1, Cell Surface Associated; Tumor-Associated Epithelial Membrane Antigen; Breast Carcinoma-Associated Antigen DF3; Peanut-Reactive Urinary Mucin; Polymorphic Epithelial Mucin; Carcinoma-Associated Mucin; Mucin 1, Transmembrane; Krebs Von Den Lungen-6; Cancer Antigen 15-3; Episialin; CA 15-3; H23AG; MUC-1; KL-6; PEMT; EMA; PUM; PEM

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.


Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "MUC1"

Humanized Antibody

CAT Product Name Application Type
TAB-173 Anti-Human MUC1 Recombinant Antibody (Cantuzumab Ravtansine) IF, IP, Neut, FuncS, ELISA, FC, ICC IgG1 - kappa
TAB-H65 Anti-Human MUC1 Recombinant Antibody (Sontuzumab) WB, ELISA, FC, IP, FuncS, IF, Neut IgG1
TAB-H77 Human Anti-MUC1 Recombinant Antibody (TAB-H77) FuncS, Inhib IgG1, κ
TAB-413MZ Human Anti-MUC1 Recombinant Antibody (TAB-413MZ) ELISA Humanized IgG
TAB-026ML Anti-Human MUC1 Recombinant Antibody (Gatipotuzumab) ELISA, IHC, FC, IP, IF, FuncS IgG1, κ


CAT Product Name Application Type
AGTO-L036E anti-MUC1 immunotoxin C242 (Fab)-PE Cytotoxicity assay, Functional assay
AGTO-L064E anti-MUC1 immunotoxin H23 (scFv)-PE Cytotoxicity assay, Functional assay

Fab Glycosylation

CAT Product Name Application Type
Gly-012LC Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) ELISA, FC, IHC Humanized antibody
Gly-120LC Recombinant Anti-Human MUC1 Antibody (Fab glycosylation) ELISA Mouse antibody

Sialylated IgG Glycan

CAT Product Name Application Type
Gly-012LC-1 Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) ELISA, FC, IHC Humanized antibody

Fc Glycosylation

CAT Product Name Application Type
Gly-109LC Recombinant Anti-Human MUC1 Antibody (Fc glycosylation) ELISA Human antibody

Deglycosylated Antibody (Non-glycosylated IgGs)

Chicken IgY Antibody

CAT Product Name Application Type
BRD-0379MZ Chicken Anti-MUC1 Polyclonal IgY IHC, WB Chicken antibody

Rabbit Monoclonal Antibody

CAT Product Name Application Type
MOR-2320 Hi-Affi™ Recombinant Rabbit Anti-MUC1 Monoclonal Antibody (DS2320AB) IHC-P, IHC-Fr IgG

ADCC Enhanced Antibody

CAT Product Name Application Type
AFC-TAB-H56 Afuco™ Anti-MUC1 ADCC Recombinant Antibody (Pemtumomab), ADCC Enhanced FuncS, IF, Neut, ELISA, FC ADCC enhanced antibody
AFC-TAB-H65 Afuco™ Anti-MUC1 ADCC Recombinant Antibody (Sontuzumab), ADCC Enhanced ELISA, FC, IP, FuncS, IF ADCC enhanced antibody
AFC-TAB-026ML Afuco™ Anti-MUC1 ADCC Recombinant Antibody (Gatipotuzumab), ADCC Enhanced ELISA, IHC, FC, IP, IF, FuncS ADCC enhanced antibody
AFC-TAB-166 Afuco™ Anti-MUC1 ADCC Recombinant Antibody (Cantuzumab), ADCC Enhanced IP, IF, FuncS, FC, Neut, ELISA ADCC enhanced antibody
AFC-TAB-H77 Afuco™ Human Anti-MUC1 Recombinant Antibody, ADCC Enhanced (AFC-TAB-H77) ELISA, FC, IP, FuncS, IF IgG1, κ

Submit a review or a question
There are currently no Customer reviews or questions for HPAB-AP738-YC-F(E). Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0

    Go to compare