Mouse Anti-MUC1 Recombinant Antibody; scFv Fragment (HPAB-AP738-YC-S(P))
CAT#: HPAB-AP738-YC-S(P)
This product is a recombinant mouse antibody scFv fragment that recognizes Mucin1. This monoclonal antibody was generated to MUC1 peptide (GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA) using standard hybridoma generation. It was screened for recognition of the MUC1 peptide by ELISA. The clone MIN-A2-1 was tested by FACS (fluorescence-activated cell sorting) for its ability to bind to MUC1 on intact cells.
Specifications
- Immunogen
- GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA
- Host Species
- Mouse
- Type
- Mouse scFv
- Specificity
- Human MUC1
- Species Reactivity
- Human
- Applications
- ELISA
- Related Disease
- Cancer
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
- Alternative Names
- Mucin 1, Cell Surface Associated; Tumor-Associated Epithelial Membrane Antigen; Breast Carcinoma-Associated Antigen DF3; Peanut-Reactive Urinary Mucin; Polymorphic Epithelial Mucin; Carcinoma-Associated Mucin; Mucin 1, Transmembrane; Krebs Von Den Lungen-6; Cancer Antigen 15-3; Episialin; CA 15-3; H23AG; MUC-1; KL-6; PEMT; EMA; PUM; PEM
- Gene ID
- 4582
- UniProt ID
- P15941
Customer Review
There are currently no Customer reviews or questions for HPAB-AP738-YC-S(P). Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "MUC1"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NAB-2049-VHH | Recombinant Anti-human MUC1 VHH Single Domain Antibody | WB, IP, ChiP, Neut, ELISA | Llama VHH |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1077z | Mouse Anti-MUC1 Recombinant Antibody (clone 18C4) | WB, FC, IF, IHC | Mouse IgG1, κ |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-173 | Anti-Human MUC1 Recombinant Antibody (TAB-173) | IF, IP, Neut, FuncS, ELISA, FC, ICC | IgG1 - kappa |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-H56 | Anti-Human MUC1 Recombinant Antibody (Pemtumomab) | WB, FuncS, IF, Neut, ELISA, FC, IP | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-H65 | Anti-Human MUC1 Recombinant Antibody (Sontuzumab) | WB, ELISA, FC, IP, FuncS, IF, Neut | IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-166 | Humanized Anti-MUC1 Recombinant Antibody (clone Cantuzumab) | IP, IF, FuncS, FC, Neut, ELISA, ICC | Humanized (from mouse) IgG1, κ |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-765 | Mouse Anti-MUC1 Recombinant Antibody (clone Nacolomab); Fab Fragment | FC, IP, ELISA, Neut, FuncS, IF, ICC | Mouse Fab (IgG1, κ) |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-037-F(E) | Anti-Human MUC1 Recombinant Antibody Fab Fragment (TAB-037-F(E)) | Neut, ELISA, IF, IP, FuncS, FC, IHC | Fab - G1 - kappa |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-H77 | Human Anti-MUC1 Recombinant Antibody (TAB-H77) | FuncS, Inhib | IgG1, κ |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AGTO-L036E | anti-MUC1 immunotoxin C242 (Fab)-PE | Cytotoxicity assay, Functional assay |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AGTO-L064E | anti-MUC1 immunotoxin H23 (scFv)-PE | Cytotoxicity assay, Functional assay |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| PABL-662 | Mouse Anti-MUC1 Recombinant Antibody | WB, IF, FuncS | Mouse IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| PFBL-656 | Mouse Anti-MUC1 Recombinant Antibody; Fab Fragment | WB, IF, FuncS | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| PSBL-656 | Mouse Anti-MUC1 Recombinant Antibody; scFv Fragment | WB, IF, FuncS | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-0278CL | Human Anti-MUC1 Recombinant Antibody (TAB-0278CL) | ELISA, Internalization, BI, FuncS | Human IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-0388CL | Mouse Anti-Human MUC1 Recombinant Antibody | WB, IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-0278CL-S(P) | Human Anti-MUC1 Recombinant Antibody; scFv Fragment (TAB-0278CL-S(P)) | ELISA, Internalization, BI, FuncS | Human scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-0388CL-S(P) | Mouse Anti-Human MUC1 Recombinant Antibody scFv Fragment | WB, IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-0278CL-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (TAB-0278CL-F(E)) | ELISA, Internalization, BI, FuncS | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-0388CL-F(E) | Mouse Anti-Human MUC1 Recombinant Antibody Fab Fragment | WB, IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-412MZ | Human Anti-MUC1 Recombinant Antibody (TAB-412MZ) | ELISA | Chimeric (mouse/human) IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-431MZ | Anti-Human MUC1 Recombinant Antibody (PH1) | ELISA, WB, FC, IHC, SPR | Human antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-432MZ | Human Anti-MUC1 Recombinant Antibody (TAB-432MZ) | ELISA, FC, FACS, DB, SPR | Human IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-412MZ-S(P) | Mouse Anti-MUC1 Recombinant Antibody; scFv Fragment (TAB-412MZ-S(P)) | ELISA | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-412MZ-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (TAB-412MZ-F(E)) | ELISA | Chimeric (mouse/human) Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| Gly-012LC | Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) | ELISA, FC, IHC | Humanized antibody |
| Gly-012LC-1 | Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) | ELISA, FC, IHC | Humanized antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| Gly-109LC | Recombinant Anti-Human MUC1 Antibody (Fc glycosylation) | ELISA | Human antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| Gly-120LC | Recombinant Anti-Human MUC1 Antibody (Fab glycosylation) | ELISA | Mouse antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| Gly-121LC | Recombinant Anti-Human MUC1 Antibody (Non-glycosylated) | ELISA | Mouse antibody |
| Gly-122LC | Recombinant Anti-Human MUC1 Antibody (Non-glycosylated) | ELISA | Mouse antibody |
| Gly-124LC | Recombinant Anti-Human MUC1 Antibody (Non-glycosylated) | ELISA | Mouse antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-0364MZ | Recombinant Mouse Anti-Human Mucin 1, Cell Surface Associated, FITC-Conjugated Antibody (clone Cer-EP5) | ELISA | Mouse antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| BRD-0379MZ | Chicken Anti-MUC1 Polyclonal IgY | IHC, WB | Chicken antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MHC-LC054 | PE-A*02:01/Human MUC1 (LLLTVLTVV) MHC Tetramer | FCM |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MHC-LC055 | APC-A*02:01/Human MUC1 (LLLTVLTVV) MHC Tetramer | FCM |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MHC-LC056 | BV421-A*02:01/Human MUC1 (LLLTVLTVV) MHC Tetramer | FCM |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MHC-LC096 | PE-A*02:01/Human MUC1 (LLLLTVLTV) MHC Tetramer | FCM |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MHC-LC097 | APC-A*02:01/Human MUC1 (LLLLTVLTV) MHC Tetramer | FCM |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-2320 | Hi-Affi™ Recombinant Rabbit Anti-MUC1 Monoclonal Antibody (DS2320AB) | IHC-P, IHC-Fr | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| EPAF-0838LC | Recombinant Mouse Anti-Human MUC1 Antibody (SM3) | ELISA | IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0091-YC | Mouse Anti-MUC1 Recombinant Antibody (HPAB-0091-YC) | ELISA, Neut | Mouse IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0094-YC | Mouse Anti-MUC1 Recombinant Antibody (clone 12D10) | ELISA, FC | Mouse IgG2a |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0091-YC-S(P) | Mouse Anti-MUC1 Recombinant Antibody; scFv Fragment (HPAB-0091-YC-S(P)) | ELISA, Neut | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0094-YC-S(P) | Mouse Anti-MUC1 Recombinant Antibody (clone 12D10); scFv Fragment | ELISA, FC | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0091-YC-F(E) | Mouse Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-0091-YC-F(E)) | ELISA, Neut | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0094-YC-F(E) | Mouse Anti-MUC1 Recombinant Antibody (clone 12D10); Fab Fragment | ELISA, FC | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| EPAF-0581CQ | Recombinant Mouse Anti-Human MUC1 Antibody (B27.29) | Neut, FC | IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| EPAF-0583CQ | Recombinant Mouse Anti-Human MUC1 Antibody (BC4E549) | Neut, FC | IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| EPAF-0584CQ | Recombinant Mouse Anti-Human MUC1 Antibody (DF3) | Neut, FC | IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0225-YC-S(P) | Mouse Anti-MUC1 Recombinant Antibody (clone MUSE11); scFv Fragment | IHC | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0225-YC-F(E) | Mouse Anti-MUC1 Recombinant Antibody (clone MUSE11); Fab Fragment | IHC | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0670-CN-S(P) | Human Anti-MUC1 Recombinant Antibody; scFv Fragment (HPAB-0670-CN-S(P)) | FC | Human scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0670-CN-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-0670-CN-F(E)) | FC | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AFC-TAB-H56 | Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H56) | FuncS, IF, Neut, ELISA, FC | ADCC enhanced antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AFC-TAB-H65 | Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H65) | ELISA, FC, IP, FuncS, IF | ADCC enhanced antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AFC-TAB-026ML | Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-026ML) | ELISA, IHC, FC, IP, IF, FuncS | ADCC enhanced antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AFC-TAB-166 | Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-166) | IP, IF, FuncS, FC, Neut, ELISA | ADCC enhanced antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AFC-TAB-H77 | Afuco™ Human Anti-MUC1 Recombinant Antibody, ADCC Enhanced (AFC-TAB-H77) | ELISA, FC, IP, FuncS, IF | IgG1, κ |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-AP504-YC | Recombinant Camel Anti-MUC1 Single Domain Antibody (HPAB-AP504-YC) | FC | Camel VHH |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-AP505-YC | Recombinant Camel Anti-MUC1 Single Domain Antibody (HPAB-AP505-YC) | ELISA | Camel VHH |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-AP745-YC | Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP745-YC) | ELISA | Mouse IgM |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0736-YJ-VHH | Camelid Anti-MUC1 Recombinant Single Domain Antibody (HPAB-0736-YJ-VHH) | ELISA | Camelid VHH |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0737-YJ-VHH | Camelid Anti-MUC1 Recombinant Single Domain Antibody (HPAB-0737-YJ-VHH) | ELISA | Camelid VHH |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0424-XY192 | AbPlus™ Anti-MUC1 Magnetic Beads (139H2) | IP, Protein Purification |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0724-YC1494 | AbPlus™ Anti-MUC1 Magnetic Beads (VS-0724-YC1494) | IP, Protein Purification |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0125-FY26 | Human Anti-MUC1 (clone 1B2) scFv-Fc Chimera | FC | Human IgG1, scFv-Fc |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0225-XY169 | CytoStream™ Mouse Anti-MUC1 Recombinant Antibody (VS-0225-XY169) | FC | Mouse IgG1, kappa |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0325-XY1394 | Anti-MUC1 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-YC379 | Recombinant Anti-MUC1 Vesicular Antibody, EV Displayed (VS-0425-YC379) | ELISA, FC, Neut, Cell-uptake |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY4575 | Anti-Human MUC1 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY4576 | Anti-Mouse MUC1 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-YC131 | Recombinant Anti-MUC1 Biparatopic Antibody, Tandem scFv | ELISA, IHC | Tandem scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0825-YC261 | SmartAb™ Recombinant Anti-MUC1 pH-dependent Antibody (VS-0825-YC261) | ELISA, IHC, Inhib | Human IgG kappa |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-1025-YC167 | Anti-MUC1 Antibody Prodrug, Protease Activated (VS-1025-YC167) | ISZ, Cyt, FuncS |
Popular Products

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: FC, IP, ELISA, Neut, FuncS, IF, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: FuncS, IF, Neut, ELISA, FC, IP, IHC

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: IP, IF, FuncS, FC, Neut, ELISA, IHC

Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, WB

Application: FuncS, Inhib, IP, ELISA
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.












