Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP740-YC) (CAT#: HPAB-AP740-YC)

This product is a recombinant mouse antibody that recognizes Mucin1. This monoclonal antibody MIN-C9-1 was generated against MUC1 peptide (GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA) using standard hybridoma generation. The antibody MIN-C9-1 was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography. MIN-C9-1 was screened for recognition of the MUC1 peptide by ELISA. The clone MIN-C9-1 was tested by FACS for its ability to bind to MUC1 on intact cells.

Specific Inquiry
  • Size:

  • Conjugation:

  • Endotoxin:

  • Purity:

  • Formats:

  • Isotype Switching:

  • Fc Engineering:

  • Modalities:

Custom Production

We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

Sequences:
Isotype :
Purity :
Endotoxin :
Quantity :
Conjugation :
Fc Engineering :
Modalities :
Other Requirements:
We require custom production
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location and Protein Expression
Normal Tissue
RNA Expression

Specifications

  • Immunogen
  • GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA
  • Host Species
  • Mouse
  • Type
  • Mouse IgG
  • Specificity
  • Human MUC1
  • Species Reactivity
  • Human
  • Applications
  • ELISA
  • Related Disease
  • Cancer

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • Mucin 1, Cell Surface Associated; Tumor-Associated Epithelial Membrane Antigen; Breast Carcinoma-Associated Antigen DF3; Peanut-Reactive Urinary Mucin; Polymorphic Epithelial Mucin; Carcinoma-Associated Mucin; Mucin 1, Transmembrane; Krebs Von Den Lungen-6; Cancer Antigen 15-3; Episialin; CA 15-3; H23AG; MUC-1; KL-6; PEMT; EMA; PUM; PEM

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "MUC1"

Select a product category from the dropdown menu below to view related products.
Please select product type
Single Domain Antibody Products Humanized Antibody Products Mouse Antibody Products Immunotoxin Products Fab Antibody Products Human Antibody Products Chimeric Antibody Products Fab Glycosylation Antibody Products Sialylated IgG Glycan Products Fc Glycosylation Antibody Products Deglycosylated Antibody Products Chicken IgY Antibody Products MHC Tetramer Products for Cancer Rabbit Monoclonal Antibody Products Epitope-Specific Antibody Products IgG Antibody Products ADCC Enhanced Antibody Products IgM Antibody Products ScFv Antibody Products Antibody Magnetic Beads ScFv-Fc Chimera Products Flow Cytometry (FC) related Reagents and Kits: Empowering Cell Function Research IHC Kit and Antibody Products: Precision Tools for Immunohistochemistry Extracellular Vesicle (EV) Antibody Products

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-AP740-YC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare