Popular Searches: Recombinant Antibody MHC Tetramer T cell Receptor Scaffold Protein
  • Home
  • MUC1
  • Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP740-YC)

Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP740-YC) (CAT#: HPAB-AP740-YC)

This product is a recombinant mouse antibody that recognizes Mucin1. This monoclonal antibody MIN-C9-1 was generated against MUC1 peptide (GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA) using standard hybridoma generation. The antibody MIN-C9-1 was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography. MIN-C9-1 was screened for recognition of the MUC1 peptide by ELISA. The clone MIN-C9-1 was tested by FACS for its ability to bind to MUC1 on intact cells.

See more Engineered Antibody products for MUC1
Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location and Protein Expression
Figure 1 IF staining of human cell line RPTEC TERT1
Figure 1 IF staining of human cell line RPTEC TERT1
(Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to plasma membrane.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/8855/1789_B9_13_cr596f381e20667_selected.jpg
Figure 2 IHC staining of human stomach
Figure 2 IHC staining of human stomach
(Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/1986/ihc_selected.jpg
Figure 3 IF staining of human cell line A-431
Figure 3 IF staining of human cell line A-431
(Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/8855/100_E7_1_blue_red_green.jpg
Figure 4 IF staining of human cell line U-2 OS
Figure 4 IF staining of human cell line U-2 OS
(Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/8855/101_E7_1_blue_red_green.jpg
Normal Tissue
Figure 5 Stomach
Figure 5 Stomach
(Glandular cells
Staining:High
Intensity: Strong
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/36/155175_A_2_1.jpg
Figure 6 Colon
Figure 6 Colon
(Endocrine cells
Staining:High
Intensity: Strong
Enterocytes
Staining:High
Intensity: Strong
Quantity: 75%-25%
Goblet cells
Staining:High
Intensity: Strong
Quantity:>75%)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/36/155175_A_9_3.jpg
Figure 7 Kidney
Figure 7 Kidney
(Collecting ducts
Staining:High
Intensity: Strong
Quantity:>75%
Distal tubules
Staining:High
Intensity: Strong
Quantity:>75%)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/36/155175_A_8_5.jpg
Figure 8 Testis
Figure 8 Testis
(Elongated or late spermatids
Staining:Medium
Intensity: Moderate
Quantity: 75%-25%)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/36/155175_A_6_6.jpg
RNA Expression
Figure 9 RNA cell line category: Group enriched (CAPAN-2, OE19, RPTEC TERT1, T-47d)
Figure 9 RNA cell line category: Group enriched (CAPAN-2, OE19, RPTEC TERT1, T-47d)
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/ENSG00000185499-MUC1

Specifications

  • Immunogen
  • GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA
  • Host Species
  • Mouse
  • Type
  • Mouse IgG
  • Specificity
  • Human MUC1
  • Species Reactivity
  • Human
  • Applications
  • ELISA
  • Related Disease
  • Cancer

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • Mucin 1, Cell Surface Associated; Tumor-Associated Epithelial Membrane Antigen; Breast Carcinoma-Associated Antigen DF3; Peanut-Reactive Urinary Mucin; Polymorphic Epithelial Mucin; Carcinoma-Associated Mucin; Mucin 1, Transmembrane; Krebs Von Den Lungen-6; Cancer Antigen 15-3; Episialin; CA 15-3; H23AG; MUC-1; KL-6; PEMT; EMA; PUM; PEM

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "MUC1"

Select a product category from the dropdown menu below to view related products.
Please select product type
Single-domain Antibody Recombinant Antibody Mouse Antibody Humanized Antibody Immunotoxin scFv Fragment Antibody Human Antibody Chimeric Antibody Fab Glycosylation Sialylated IgG Glycan Fc Glycosylation Deglycosylated Antibody (Non-glycosylated IgGs) Chicken IgY Antibody MHC Tetramer for Cancer Rabbit Monoclonal Antibody Epitope-Specific Antibody Fab Fragment Antibody ADCC Enhanced Antibody IgM Antibody Antibody Magnetic Beads
CAT Product Name Application Type
NAB-2049-VHH Recombinant Anti-human MUC1 VHH Single Domain Antibody WB, IP, ChiP, Neut, ELISA Llama VHH
HPAB-AP504-YC Recombinant Camel Anti-MUC1 Single Domain Antibody (HPAB-AP504-YC) FC Camel VHH
HPAB-AP505-YC Recombinant Camel Anti-MUC1 Single Domain Antibody (HPAB-AP505-YC) ELISA Camel VHH
HPAB-0736-YJ-VHH Camelid Anti-MUC1 Recombinant Single Domain Antibody (HPAB-0736-YJ-VHH) ELISA Camelid VHH
HPAB-0737-YJ-VHH Camelid Anti-MUC1 Recombinant Single Domain Antibody (HPAB-0737-YJ-VHH) ELISA Camelid VHH

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-AP740-YC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers

Figure 1 Anti-Human Nogo-A Recombinant Antibody (TAB-903) in SDS-PAGE

Anti-Human Nogo-A Recombinant Antibody (Ozanezumab) (CAT# TAB-903)
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

Figure 1 Anti-Human MUC5AC Recombinant Antibody (TAB-200) in SDS-PAGE

Anti-Human MUC5AC Recombinant Antibody (Ensituximab) (CAT# TAB-200)
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Figure 1 Human TWEAK receptor Therapeutic Antibody (TAB-178) in ELISA

Anti-Human TWEAK receptor Recombinant Antibody (Enavatuzumab) (CAT# TAB-178)
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Figure 1 Mouse Anti-EREG Recombinant Antibody (PABL-084) in SDS-PAGE

Mouse Anti-EREG Recombinant Antibody (clone 9E5) (CAT# PABL-084)
Application: ELISA, WB, FuncS

Figure 1 Human Anti-TSHR Recombinant Antibody (PABL-737) in SDS-PAGE

Human Anti-TSHR Recombinant Antibody (clone K1-70) (CAT# PABL-737)
Application: Block

Figure 1 Anti-Human BTLA Recombinant Antibody (TAB-1310CL) in SDS-PAGE

Human Anti-BTLA Recombinant Antibody (TAB-1310CL) (CAT# TAB-1310CL)
Application: Block

Figure 1 Anti-CD3 Recombinant Antibody (TAB-0416CL-F(E)) in SDS-PAGE

Anti-Human CD3 Recombinant Antibody Fab Fragment (OKT3) (CAT# TAB-0416CL-F(E))
Application: IB, ELISA, FC, FuncS

Figure 1 Anti-Human CD47 Recombinant Antibody (TAB-303LC) in WB

Human Anti-CD47 Recombinant Antibody (TAB-303LC) (CAT# TAB-303LC)
Application: ELISA

Figure 1 Anti-Human FAP Antibody (TAB-024WM) in WB

Human Anti-FAP Recombinant Antibody (TAB-024WM) (CAT# TAB-024WM)
Application: IHC, ELISA, FC, IF

Figure 1 Anti-Human RNF43 Recombinant Antibody (TAB-328CT) in SDS-PAGE

Humanized Anti-RNF43 Recombinant Antibody (TAB-328CT) (CAT# TAB-328CT)
Application: WB, ELISA, FC, IHC, IP

Figure 1 Anti-Human SIRPA Antibody (TAB-453CT) in WB

Human Anti-SIRPA Recombinant Antibody (TAB-453CT) (CAT# TAB-453CT)
Application: Cyt, IF, FC

Figure 1 Mouse Anti-TNFSF4 Recombinant Antibody (NEUT-2204CQ) in SDS-PAGE

Mouse Anti-TNFSF4 Recombinant Antibody (clone R4930) (CAT# NEUT-2204CQ)
Application: FC, Block

Figure 1 Recombinant Mouse Anti-HSPA1A Antibody (HPAB-0243-YC) in SDS-PAGE

Mouse Anti-HSPA1A Recombinant Antibody (clone cmHsp70.1) (CAT# HPAB-0243-YC)
Application: ELISA, FC

Figure 1 Anti-Human CD47 Antibody in WB

Human Anti-CD47 Recombinant Antibody (HPAB-0008-FY) (CAT# HPAB-0008-FY)
Application: ELISA, PD, Activ, PK, Stim

Figure 1 Recombinant Human Anti-HBV preS1 Antibody (PABC-406) in SDS-PAGE

Recombinant Human Anti-HBV preS1 Antibody (2H5-A14) (CAT# PABC-406)
Application: Neut, IHC, Activ, FuncS, IF, ELISA

Figure 1 Recombinant Human Anti-LAM Antibody (HPAB-M0560-YC) in SDS-PAGE

Human Anti-LAM Recombinant Antibody (HPAB-M0560-YC) (CAT# HPAB-M0560-YC)
Application: ELISA, WB, Microarray, Block

Figure 1 Afuco Anti-RSV F ADCC Recombinant Antibody (Palivizumab), ADCC Enhanced (AFC-TAB-009) in SDS-PAGE

Afuco™ Anti-RSV F ADCC Recombinant Antibody (Palivizumab), ADCC Enhanced (CAT# AFC-TAB-009)
Application: IF, IP, Neut, FuncS, ELISA, FC

Figure 1 Recombinant Mouse Anti-Id (Idiotype) Antibody (HPAB-0644-WJ) in SDS-PAGE

Recombinant Mouse Anti-Id (Idiotype) Antibody (Ganglidiomab) (CAT# HPAB-0644-WJ)
Application: ELISA, WB

Figure 1 Mouse Anti-MPO Recombinant Antibody (MOB-0130F) in IHC

Mouse Anti-MPO Recombinant Antibody (MOB-0130F) (CAT# MOB-0130F)
Application: IHC-P, IF

Figure 1. Recombinant Rabbit Anti-NR4A1 Antibody (clone R02-1C7) in WB.

Recombinant Rabbit Anti-NR4A1 Antibody (clone R02-1C7) (CAT# VS3-FY1068)
Application: WB

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

  • 0
  • 0
Cart
    Inquiry
    Go to compare

    Go to compare