PE-DRB1*04:01/Human MAGEA6 (VGNWQYFFPVIFSKASDSLQLVFGIELMEVD) MHC Tetramer (CAT#: MHC-LC3328)
This product is a tetramer of biotinylated peptide/MHC complex with streptavidin mainly composed of human MAGEA6 of peptide VGNWQYFFPVIFSKASDSLQLVFGIELMEVD covering 140-170 and DRB1*04:01 molecule. The pMHC tetramer recognizes CD4 T cells, and can be used in the analysis of individual antigen-specific T cells.
MHC tetramer custom production provides a vital tool for researchers seeking to understand and manipulate T-cell immunity with exceptional precision. Please specify your requirements, including peptide sequence, MHC allele, and desired fluorophore etc. We will respond as soon as possible with a tailored solution.

(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/ENSG00000197172-MAGEA6
Specifications
- Allele
- DRB1*04:01
- Class
- Class II
- MHC Species
- Human
- Antigen
- MAGEA6
- Antigen Species
- Human
- Peptide
- VGNWQYFFPVIFSKASDSLQLVFGIELMEVD
- Range
- 140-170
- Conjugate
- PE
- Application
- FCM
Target
- Antigen Introduction
- This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
- Alternative Names
- MAGEA6; Melanoma-associated antigen 6; CT1.6; MAGE6; MAGE3B; MAGE-3b
- Gene ID
- 4105
- UniProt ID
- P43360
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "MAGEA6"
Select a product category from the dropdown menu below to view related products.
Customer Reviews and Q&As
There are currently no Customer reviews or questions for MHC-LC3328. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: ELISA, IP, FC, FuncS, Neut, IF, ICC
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: WB, FuncS, IF, Neut, ELISA, FC, IP
Application: ELISA, FC, IP, FuncS, IF, Neut, WB
Application: WB, ELISA, FC, IHC, IP
Application: ELISA, IHC, FC, IP, IF, BL
Application: ELISA, Neut
Application: ELISA, Cyt, PP, Inhib
For Research Use Only. Not For Clinical Use.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.