PE-DRB1*07:01/Human MAGEA6 (VGNWQYFFPVIFSKASDSLQLVFGIELMEVD) MHC Tetramer (CAT#: MHC-LC3330)

This product is a tetramer of biotinylated peptide/MHC complex with streptavidin mainly composed of human MAGEA6 of peptide VGNWQYFFPVIFSKASDSLQLVFGIELMEVD covering 140-170 and DRB1*07:01 molecule. The pMHC tetramer recognizes CD4 T cells, and can be used in the analysis of individual antigen-specific T cells.

Specific Inquiry
  • Size:
Custom Production

MHC tetramer custom production provides a vital tool for researchers seeking to understand and manipulate T-cell immunity with exceptional precision. Please specify your requirements, including peptide sequence, MHC allele, and desired fluorophore etc. We will respond as soon as possible with a tailored solution.

Peptide Sequence *:
Allele Requested *:
Antigen Species:
Antigen Molecule:
Sequence Position:
Form Requested *:
Conjugation *:
Size *:
Comments:

Disclaimer: Please note that the MHC reagents we offered have been produced with strict quality control (including gene sequencing, affinity purification, SDS-PAGE analysis, and verification of biotinylation), but many have not been confirmed to stain or activate specific T cells.

We require custom production
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
RNA Expression

Specifications

  • Allele
  • DRB1*07:01
  • Class
  • Class II
  • MHC Species
  • Human
  • Antigen
  • MAGEA6
  • Antigen Species
  • Human
  • Peptide
  • VGNWQYFFPVIFSKASDSLQLVFGIELMEVD
  • Range
  • 140-170
  • Conjugate
  • PE
  • Application
  • FCM

Target

  • Antigen Introduction
  • This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
  • Alternative Names
  • MAGEA6; Melanoma-associated antigen 6; CT1.6; MAGE6; MAGE3B; MAGE-3b

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "MAGEA6"

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for MHC-LC3330. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare