Recombinant Mouse Anti-C. botulinum botE Antibody (EK19-7)
CAT#: EPAF-1270LC
This product is a mouse monoclonal antibody that specifically recognizes KNELTNKYDIKQIENELNQKVSIAMNNIDRFLTESSISYLMKIINEVKINKLREYDE, which is an linear epitope on Botulinum neurotoxin type E from Clostridium botulinum. The botE-binding antibody EK19-7 is an epitope-specific antibody that can be used in western blotting.
Specifications
- Host Species
- Mouse
- Specificity
- Clostridium botulinum Botulinum neurotoxin type E
- Species Reactivity
- C. botulinum
- Clone
- EK19-7
- Applications
- Western Blot
Target
- Alternative Names
- C. botulinum botE; Clostridium botulinum; C. botulinum; botE; Botulinum neurotoxin type E
- UniProt ID
- Q00496
Customer Review
There are currently no Customer reviews or questions for EPAF-1270LC. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "C. botulinum botE"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
EPAF-0429LC | Recombinant Human Anti-C. botulinum botE Antibody (3E6.1) | ELISA | IgG1 |
EPAF-0430LC | Recombinant Human Anti-C. botulinum botE Antibody (4E17.1) | ELISA | IgG1 |
EPAF-0678LC | Recombinant Mouse Anti-C. botulinum botE Antibody (EL221-3) | ELISA | IgG1 |
EPAF-0680LC | Recombinant Mouse Anti-C. botulinum botE Antibody (EL161-38) | ELISA | IgG1 |
EPAF-0682LC | Recombinant Mouse Anti-C. botulinum botE Antibody (LE15-5) | ELISA | IgG1 |
Popular Products
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: FC, IP, ELISA, Neut, FuncS, IF, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: Neut, FC
Application: ELISA
Application: WB, ELISA, FC, IHC, IF, IP
Application: ELISA, Inhib, FuncS
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.