Popular Searches: Recombinant Antibody MHC Tetramer T cell Receptor Scaffold Protein

Recombinant Mouse Anti-RABV (RCEH) NP Antibody (MoAb 6) (CAT#: EPAF-1206LC)

This product is a mouse monoclonal antibody that specifically recognizes AIKDLKKPCITLGKAPDLNKAYKSVLSGMNAAKLDPDDVCS, which is an linear epitope on Nucleoprotein from Rabies virus RCEH. The NP-binding antibody MoAb 6 is an epitope-specific antibody that can be used in blocking study.

Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Formats:
  • Isotype Switching:
  • Fc Engineering:
  • Modalities:
  • Datasheet
  • MSDS
  • COA

Specifications

  • Host Species
  • Mouse
  • Specificity
  • Rabies virus RCEH Nucleoprotein
  • Species Reactivity
  • Rabies virus RCEH
  • Clone
  • MoAb 6
  • Applications
  • Blocking

Target

  • Alternative Names
  • RABV (RCEH) NP; Rabies virus RCEH; RABV (RCEH); NP; Nucleoprotein

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for EPAF-1206LC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers

Figure 1 Anti-Human IL17RA Antibody (TAB-134) in ELISA

Human Anti-IL17RA Recombinant Antibody (TAB-134) (CAT# TAB-134)
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Figure 2 Anti-Human Met (TAB-190-F(E)) in ELISA

Anti-Human Met(Onartuzumab) (CAT# TAB-190-F(E))
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Figure 1 Anti-Human CD18 Recombinant Antibody, hIgG1 (TAB-154-F(E)) in SDS-PAGE

Anti-Human CD18 Recombinant Antibody F(ab')2 Fragment (TAB-154-F(E)) (CAT# TAB-154-F(E))
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Figure 1 Human Anti-MET Recombinant Antibody (PABL-271) in SDS-PAGE

Human Anti-MET Recombinant Antibody (PABL-271) (CAT# PABL-271)
Application: WB, Block, FuncS

Figure 1 Human Anti-FGFR3 Recombinant Antibody (PABL-474) in SDS-PAGE

Human Anti-FGFR3 Recombinant Antibody (clone R3Mab) (CAT# PABL-474)
Application: ELISA

Figure 1 Anti-Human IgE Antibody (TAB-095ZJ) in SDS-PAGE

Anti-Human IgE Single Domain Antibody (TAB-095ZJ), Research Grade Biosimilar (CAT# TAB-095ZJ)
Application: ELISA, Inhib, FC

Figure 1 Anti-Human Tau Recombinant Antibody (TAB-528CT) in SDS-PAGE

Anti-Human Tau Recombinant Antibody (ADx202) (CAT# TAB-528CT)
Application: WB, ELISA, IHC

Figure 1 Human Anti-RSV F Recombinant Antibody (MRO-878LC) in WB

Human Anti-RSV F Recombinant Antibody (MRO-878LC) (CAT# MRO-878LC)
Application: ELISA, Neut

Figure 1 Anti-CD276 Antibody (TAB-424CQ) in ELISA

Anti-Human CD276 Recombinant Antibody (TAB-424CQ) (CAT# TAB-424CQ)
Application: ELISA, IHC, FC, IP, IF, FuncS

Figure 1 Anti-CD19 Antibody in ELISA.

Anti-Human CD19 Recombinant Antibody (CAT# TAB-431CQ)
Application: ELISA, IHC, FC, IP, IF, FuncS

Figure 1 Recombinant Mouse Anti-HSPA1A Antibody (HPAB-0243-YC) in SDS-PAGE

Mouse Anti-HSPA1A Recombinant Antibody (HPAB-0243-YC) (CAT# HPAB-0243-YC)
Application: ELISA, FC

Figure 1 Human IgG1, lambda Isotype Control Antibody (MOB-173CQ) in SDS-PAGE

Human IgG1, lambda Isotype Control Antibody (CAT# MOB-173CQ)
Application: ELISA

Figure 1 Anti-MAPT Recombinant Antibody (NS-090CN) in DB

Mouse Anti-MAPT Recombinant Antibody (NS-090CN) (CAT# NS-090CN)
Application: WB, ELISA, IHC, IP, SPR, FuncS

Figure 1 Mouse Anti-VEGFA Recombinant Antibody (clone mAb G6-31) (HPAB-0330CQ) in SDS-PAGE

Mouse Anti-VEGFA Recombinant Antibody (clone mAb G6-31) (CAT# HPAB-0330CQ)
Application: ELISA, IF, Block, FuncS

Figure 1 Mouse Anti-RSV F Antibody (PABC-276) in SDS-PAGE

Recombinant Mouse Anti-RSV F Antibody (PABC-276) (CAT# PABC-276)
Application: ELISA, Neut, DB, FC

Figure 1 Human Anti-IgE Fc Recombinant Antibody (PABC-341) in WB

Human Anti-IgE Fc Recombinant Antibody (PABC-341) (CAT# PABC-341)
Application: FC

Figure 1 Recombinant Mouse Anti-EBV gH/gL Antibody (PABC-524) in SDS-PAGE

Recombinant Mouse Anti-EBV gH/gL Antibody (E1D1) (CAT# PABC-524)
Application: ELISA, FC, Neut, Inhib

Figure 1 Mouse Anti-CRTAM Recombinant Antibody (HPAB-1089-FY) in SDS-PAGE

Mouse Anti-CRTAM Recombinant Antibody (clone 17B2) (CAT# HPAB-1089-FY)
Application: WB, FC

Figure 1 Human Anti-HLA-B27 Recombinant Antibody (clone HD5) (HPAB-J0121-YC) in SEC-HPLC

Human Anti-HLA-B27 Recombinant Antibody (clone HD5) (CAT# HPAB-J0121-YC)
Application: ELISA, Block, WB, FC, IP

Figure 1 Human Anti-CLDN18 Antibody (ZG-0140U) in FC

Human Anti-CLDN18 Recombinant Antibody (clone 25E3) (CAT# ZG-0140U)
Application: ELISA, FC

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

  • 0
  • 0
Cart
    Inquiry
    Go to compare

    Go to compare