Recombinant Mouse Anti-BTV-1 VP7 Antibody (20A11)
CAT#: EPAF-1515LC
This product is a mouse monoclonal antibody that specifically recognizes GVTVSVGGVDMRAGRIIAWDGQAALQIHNPTQQN, which is an linear epitope on Core protein VP7 from Bluetongue virus-1. The VP7-binding antibody 20A11 is an epitope-specific antibody that can be used in western blotting.
Specifications
- Host Species
- Mouse
- Specificity
- Bluetongue virus-1 Core protein VP7
- Species Reactivity
- BTV-1
- Clone
- 20A11
- Applications
- Western Blot
Target
- Alternative Names
- BTV-1 VP7; Bluetongue virus-1; BTV-1; VP7; Core protein VP7
- UniProt ID
- P26560
Customer Review
There are currently no Customer reviews or questions for EPAF-1515LC. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "BTV-1 VP7"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
EPAF-1516LC | Recombinant Mouse Anti-BTV-1 VP7 Antibody (20D11) | WB |
Popular Products
Application: ELISA, Neut, IF, IP, FC, FuncS
Application: WB, Neut, ELISA, IF, IP, FuncS, FC
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application:
Application: Neut, Inhib, FC, ELISA
Application: ELISA
Application: ELISA, WB, FC, IHC, IP
Application: FC
Application: ELISA, Block, WB, FC, IP
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.