1 0
Cart
    Inquiry
    Popular Searches: Recombinant Antibody MHC Tetramer T cell Receptor Scaffold Protein

    Recombinant Mouse Anti-H1N1 M1 Antibody (M1-1C6) (CAT#: EPAF-1109LC)

    This product is a mouse monoclonal antibody that specifically recognizes LKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGD, which is an linear epitope on Matrix protein 1 from Influenza A virus H1N1. The M1-binding antibody M1-1C6 is an epitope-specific antibody that can be used in western blotting.

    Specific Inquiry
    • Size:

    • Conjugation:

    • Endotoxin:

    • Purity:

    • Formats:

    • Isotype Switching:

    • Fc Engineering:

    • Modalities:

    Custom Production

    We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

    Sequences:
    Isotype :
    Purity :
    Endotoxin :
    Quantity :
    Conjugation :
    Fc Engineering :
    Modalities :
    Other Requirements:
    We require custom production
    • Datasheet
    • MSDS
    • COA

    Specifications

    • Host Species
    • Mouse
    • Specificity
    • Influenza A virus H1N1 Matrix protein 1
    • Species Reactivity
    • Influenza A virus H1N1
    • Clone
    • M1-1C6
    • Applications
    • Western Blot

    Target

    • Alternative Names
    • H1N1 M1; Influenza A virus H1N1; H1N1; M1; Matrix protein 1

    Product Notes

    This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

    • Increased sensitivity
    • Confirmed specificity
    • High repeatability
    • Excellent batch-to-batch consistency
    • Sustainable supply
    • Animal-free production

    See more details about Hi-Affi™ recombinant antibody benefits.

    Downloads

    Download resources about recombinant antibody development and antibody engineering to boost your research.

    See other products for "H1N1 M1"

    Select a product category from the dropdown menu below to view related products.
    Please select product type
    Epitope-Specific Antibody Products
    CAT Product Name Application Type
    EPAF-1110LC Recombinant Mouse Anti-H1N1 M1 Antibody (M1-289/4) WB
    EPAF-1180LC Recombinant Mouse Anti-H1N1 M1 Antibody (1G11-D11) WB

    Customer Reviews and Q&As

    Submit a review or a question

    There are currently no Customer reviews or questions for EPAF-1109LC. Click the button above to contact us or submit your feedback about this product.

    Popular products with customers

    Figure 1 Anti-Human CTLA4 Antibody (TAB-206) in SDS-PAGE

    Anti-Human CTLA4 Recombinant Antibody (Ticilimumab (Tremelimumab)) (CAT# TAB-206)
    Application: WB, IF, IP, Neut, FuncS, ELISA, FC

    Figure 1 Anti-alpha 4 beta 7 Antibody (TAB-H75) in ELISA

    Anti-Human ITGA4+ITGB7 Recombinant Antibody (TAB-H75) (CAT# TAB-H75)
    Application: FC, IP, ELISA, Neut, FuncS, IF, WB

    Figure 1 Selectin P Recombinant Antibody (TAB-246) in Dot Blot

    Anti-Human selectin P Recombinant Antibody (Inclacumab) (CAT# TAB-246)
    Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

    Figure 1 Anti-Human CD30 Therapeutic Antibody (TAB-153) in ELISA

    Chimeric (Mouse/Human) Anti-TNFRSF8 Recombinant Antibody (TAB-153) (CAT# TAB-153)
    Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

    Figure 1 Anti-Human IL1 beta Recombinant Antibody (TAB-161) in SDS-PAGE

    Anti-Human IL1 beta Recombinant Antibody (TAB-161) (CAT# TAB-161)
    Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

    Figure 1 Anti-Human EGFR Antibody (TAB-003) in ELISA

    Anti-Human EGFR Recombinant Antibody (Cetuximab) (CAT# TAB-003)
    Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

    Figure 1 Anti-HIV-1 gp120 Antibody (PABL-163) in WB

    Human Anti-HIV-1 gp120 Recombinant Antibody (clone 3bnc117) (CAT# PABL-163)
    Application: Neut, ELISA, FuncS

    Figure 1 Recombinant Mouse Anti-N. meningitidis PorA (P1.2) Antibody (PABW-092) in SDS-PAGE

    Recombinant Mouse Anti-N. meningitidis PorA (P1.2) Antibody (MN16C13F4) (CAT# PABW-092)
    Application: ELISA

    Figure 1 Human TIM3 Recombinant Antibody (TAB-0366CL) in ELISA

    Anti-Human TIM3 Recombinant Antibody (TSR-022) (CAT# TAB-0366CL)
    Application: FC, FuncS

    Figure 1 Anti-CD3 Recombinant Antibody (TAB-0416CL-F(E)) in SDS-PAGE

    Mouse Anti-CD3 Recombinant Antibody Fab Fragment (TAB-0416CL-F(E)) (CAT# TAB-0416CL-F(E))
    Application: IB, ELISA, FC, FuncS

    Figure 1 Anti-Human CD47 Recombinant Antibody (TAB-303LC) in WB

    Human Anti-CD47 Recombinant Antibody (TAB-303LC) (CAT# TAB-303LC)
    Application: ELISA

    Figure 1 Anti-Mouse F11 Recombinant Antibody (TAB-020WM) in SDS-PAGE

    Mouse Anti-F11 Recombinant Antibody (TAB-020WM) (CAT# TAB-020WM)
    Application: WB

    Figure 1 Mouse Anti-FCGR2B Antibody (TAB-036WM) in WB

    Mouse Anti-FCGR2B Recombinant Antibody (TAB-036WM) (CAT# TAB-036WM)
    Application: ELISA, FC, Inhib

    Figure 1 Anti-Human IgE Recombinant Antibody Fab Fragment (CMAB007) in WB.

    Anti-Human IgE Recombinant Antibody Fab Fragment (CMAB007) (CAT# TAB-034ZJ-F(E))
    Application: ELISA

    Figure 1 Anti-Human SLC34A2 Recombinant Antibody (TAB-467MZ) in SDS-PAGE

    Mouse Anti-SLC34A2 Recombinant Antibody (TAB-467MZ) (CAT# TAB-467MZ)
    Application: FC, Inhib

    Figure 1 Anti-BNP Antibody (PABX-017) in ELISA

    Recombinant Mouse Anti-BNP Antibody (106.3) (CAT# PABX-017)
    Application: FuncS

    Figure 1 Mouse Anti-SOST Recombinant Antibody (HPAB-0343-YC) in SDS-PAGE

    Mouse Anti-SOST Recombinant Antibody (HPAB-0343-YC) (CAT# HPAB-0343-YC)
    Application: FuncS

    Figure 1 Mouse Anti-ανβ8 Recombinant Antibody (HPAB-N0303-YC) in WB

    Mouse Anti-ανβ8 Recombinant Antibody (HPAB-N0303-YC) (CAT# HPAB-N0303-YC)
    Application: ELISA, Block

    Figure 1 Mouse Anti-OxPL Recombinant Antibody (HPAB-0399-YJ) in SDS-PAGE

    Mouse Anti-OxPL Recombinant Antibody (clone E06) (CAT# HPAB-0399-YJ)
    Application: ELISA, FuncS

    Figure 1 Human Anti-SIRPA Antibody (PABJ-0084) in ELISA

    Human Anti-SIRPA Recombinant Antibody (PABJ-0084) (CAT# PABJ-0084)
    Application: ELISA, Block

    For Research Use Only. Not For Clinical Use.

    For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

    Send Inquiry

    This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

    Go to compare

    Go to compare