Recombinant Mouse Anti-P. falciparum MSP-1 Antibody (5B1) (CAT#: EPAF-1325LC)

This product is a mouse monoclonal antibody that specifically recognizes NISQHQCVKKQCPENSGCFRHLDEREECKCLLNYKQEGDKCVENPNPT, which is an linear epitope on Merozoite surface protein 1 from Plasmodium falciparum. The MSP-1-binding antibody 5B1 is an epitope-specific antibody that can be used in western blotting.


Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Datasheet
  • MSDS
  • COA

Specifications

  • Host Species
  • Mouse
  • Type
  • IgG
  • Specificity
  • Plasmodium falciparum Merozoite surface protein 1
  • Species Reactivity
  • P. falciparum
  • Clone
  • 5B1
  • Applications
  • Western Blot

Target

  • Alternative Names
  • P. falciparum MSP-1; Plasmodium falciparum; P. falciparum; MSP-1; Merozoite surface protein 1

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "P. falciparum MSP-1"

Customer Reviews and Q&As

Submit a review or a question
There are currently no Customer reviews or questions for EPAF-1325LC. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0
Cart

    Go to compare