Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM81)
CAT#: MRO-318-MZ
This antibody is a recombinant mouse monoclonal antibody which specifically reacts with Mycobacterium tuberculosis 38kDa.
Specifications
- Immunogen
- Recombinant full length protein corresponding to Mycobacterium tuberculosis 38kDa aa 1-340
Sequence:
MELGSLIRATNLWGYTDLMRELGADPLPFLRRFDIPPGIEHQEDAFMSLA GFVRMLEASAAELDCPDFGLRLARWQGLGILGPVAVIARNAATLFGGLEA IGRYLYVHSPALTLTVSSTTARSNVRFGYEVTEPGIPYPLQGYELSMANA ARMIRLLGGPQARARVFSFRHAQLGTDAAYREALGCTVRFGRTWCGFEVD HRLAGRPIDHADPETKRIATKYLESQYLPSDATLSERVVGLARRLLPTGQ CSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGLY LSQIAVLLGYSEQSALNRSCRRWFGMTPRQYRAYGGVSGR
- Host Species
- Mouse
- Type
- Mouse antibody
- Specificity
- Mycobacterium tuberculosis
- Clone
- HTM81
- Applications
- WB, ELISA
Target
- Alternative Names
- Mycobacterium tuberculosis 38kDa
Customer Review
There are currently no Customer reviews or questions for MRO-318-MZ. Click the button above to contact us or submit your feedback about this product.



Q&As
-
What are the primary research applications for the M. tuberculosis 38kDa antibody?
A: The Recombinant Anti-M. tuberculosis 38kDa Antibody is predominantly used in the study of tuberculosis pathogenesis and immune response. It plays a critical role in identifying and characterizing the presence of the M. tuberculosis bacteria in various samples through techniques such as Western Blotting and ELISA. This aids researchers in understanding the bacterium's interactions with host cells, contributing to the development of diagnostic assays and potential therapeutic strategies.
-
What diseases can be studied using this antibody?
A: Primarily, this antibody facilitates the study of tuberculosis, particularly in terms of bacterial detection and immune system responses. It is instrumental in researching infection dynamics and host-pathogen interactions, which are critical for understanding tuberculosis pathogenesis and developing new diagnostic tools and vaccines.
-
What role does the antibody play in protein interactions?
A: Given its specificity, the antibody aids in elucidating protein-protein interactions involving the M. tuberculosis 38kDa antigen. These insights are valuable for understanding the molecular mechanisms of the bacterium's virulence and interaction with host immune factors, critical for advancing tuberculosis research.
View the frequently asked questions answered by Creative Biolabs Support.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "M. tuberculosis 38 kD"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MRO-319-MZ | Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM82) | ELISA, WB | Mouse antibody |
Popular Products
Application: FC, IP, ELISA, Neut, FuncS, IF, ICC
Application: ELISA, WB, BLI, SPR
Application: Neut, ELISA, FuncS
Application: WB, Neut, FuncS
Application: IHC, ELISA, FC, WB, ADCC, FuncS
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: IF, IP, Neut, FuncS, ELISA, FC
Application: FC
Application: ELISA
Application: ELISA, WB
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.