Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM81) (CAT#: MRO-318-MZ)
This antibody is a recombinant mouse monoclonal antibody which specifically reacts with Mycobacterium tuberculosis 38kDa.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.
Specifications
- Immunogen
- Recombinant full length protein corresponding to Mycobacterium tuberculosis 38kDa aa 1-340
Sequence:
MELGSLIRATNLWGYTDLMRELGADPLPFLRRFDIPPGIEHQEDAFMSLA GFVRMLEASAAELDCPDFGLRLARWQGLGILGPVAVIARNAATLFGGLEA IGRYLYVHSPALTLTVSSTTARSNVRFGYEVTEPGIPYPLQGYELSMANA ARMIRLLGGPQARARVFSFRHAQLGTDAAYREALGCTVRFGRTWCGFEVD HRLAGRPIDHADPETKRIATKYLESQYLPSDATLSERVVGLARRLLPTGQ CSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGLY LSQIAVLLGYSEQSALNRSCRRWFGMTPRQYRAYGGVSGR
- Host Species
- Mouse
- Type
- Mouse antibody
- Specificity
- Mycobacterium tuberculosis
- Clone
- HTM81
- Applications
- WB, ELISA
Target
- Alternative Names
- Mycobacterium tuberculosis 38kDa
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "M. tuberculosis 38 kD"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MRO-319-MZ | Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM82) | ELISA, WB | Mouse antibody |
Customer Reviews and Q&As
Reliable TB Research Tool
Excellent Service and Product Quality
Superior Detection in TB Pathogenesis Research
Popular products with customers
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: ELISA, Neut, IF, IP, FC, FuncS
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: WB, FuncS, IF, Neut, ELISA, FC, IP
Application: ELISA, WB, Neut, Funcs, IHC, Inhib
Application: ELISA, Inhib, FuncS
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.