Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM81) (CAT#: MRO-318-MZ)

This antibody is a recombinant mouse monoclonal antibody which specifically reacts with Mycobacterium tuberculosis 38kDa.

Specific Inquiry
  • Size:

  • Conjugation:

  • Endotoxin:

  • Purity:

  • Formats:

  • Isotype Switching:

  • Fc Engineering:

  • Modalities:

Custom Production

We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

Sequences:
Isotype :
Purity :
Endotoxin :
Quantity :
Conjugation :
Fc Engineering :
Modalities :
Other Requirements:
We require custom production
  • Datasheet
  • MSDS
  • COA

Specifications

  • Immunogen
  • Recombinant full length protein corresponding to Mycobacterium tuberculosis 38kDa aa 1-340
    Sequence:
    MELGSLIRATNLWGYTDLMRELGADPLPFLRRFDIPPGIEHQEDAFMSLA GFVRMLEASAAELDCPDFGLRLARWQGLGILGPVAVIARNAATLFGGLEA IGRYLYVHSPALTLTVSSTTARSNVRFGYEVTEPGIPYPLQGYELSMANA ARMIRLLGGPQARARVFSFRHAQLGTDAAYREALGCTVRFGRTWCGFEVD HRLAGRPIDHADPETKRIATKYLESQYLPSDATLSERVVGLARRLLPTGQ CSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGLY LSQIAVLLGYSEQSALNRSCRRWFGMTPRQYRAYGGVSGR
  • Host Species
  • Mouse
  • Type
  • Mouse antibody
  • Specificity
  • Mycobacterium tuberculosis
  • Clone
  • HTM81
  • Applications
  • WB, ELISA

Target

  • Alternative Names
  • Mycobacterium tuberculosis 38kDa

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "M. tuberculosis 38 kD"

Select a product category from the dropdown menu below to view related products.
Please select product type
IgG Antibody Products
CAT Product Name Application Type
MRO-319-MZ Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM82) ELISA, WB Mouse antibody

Customer Reviews and Q&As

Customer Review Q&As

Submit a review or a question


Reliable TB Research Tool
As a long-time researcher in infectious diseases, I have found the Recombinant Anti-M. tuberculosis 38kDa Antibody indispensable in my work. Its high specificity and sensitivity make it a reliable tool for detecting M. tuberculosis in samples. The consistent quality across batches is commendable, ensuring that our results are both accurate and repeatable. Creative Biolabs' service has always been supportive, providing prompt assistance whenever needed.

Excellent Service and Product Quality
The quality offered by Creative Biolabs in their Recombinant Anti-M. tuberculosis 38kDa Antibody is exemplary. It integrates well into our workflow with no disruption, thanks to its stability and high specificity. Delivery is prompt, and the support team ensures all our concerns are duly addressed. This has undoubtedly increased our lab's efficiency in ongoing research projects.

Superior Detection in TB Pathogenesis Research
This antibody allows for superior detection in TB pathogenesis research. Its effectiveness in Western Blotting and ELISA is unmatched. Each order, backed by Creative Biolabs, arrives with precise documentation. Their customer service team has ensured a smooth transaction each time, proving them a partner truly dedicated to advancing scientific inquiry.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare