Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM81)

CAT#: MRO-318-MZ

This antibody is a recombinant mouse monoclonal antibody which specifically reacts with Mycobacterium tuberculosis 38kDa.

Specifications

  • Immunogen
  • Recombinant full length protein corresponding to Mycobacterium tuberculosis 38kDa aa 1-340
    Sequence:
    MELGSLIRATNLWGYTDLMRELGADPLPFLRRFDIPPGIEHQEDAFMSLA GFVRMLEASAAELDCPDFGLRLARWQGLGILGPVAVIARNAATLFGGLEA IGRYLYVHSPALTLTVSSTTARSNVRFGYEVTEPGIPYPLQGYELSMANA ARMIRLLGGPQARARVFSFRHAQLGTDAAYREALGCTVRFGRTWCGFEVD HRLAGRPIDHADPETKRIATKYLESQYLPSDATLSERVVGLARRLLPTGQ CSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGLY LSQIAVLLGYSEQSALNRSCRRWFGMTPRQYRAYGGVSGR
  • Host Species
  • Mouse
  • Type
  • Mouse antibody
  • Specificity
  • Mycobacterium tuberculosis
  • Clone
  • HTM81
  • Applications
  • WB, ELISA

Target

  • Alternative Names
  • Mycobacterium tuberculosis 38kDa
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for MRO-318-MZ. Click the button above to contact us or submit your feedback about this product.
Breast cancer biomarkers at key points during disease progression
Reliable TB Research Tool
As a long-time researcher in infectious diseases, I have found the Recombinant Anti-M. tuberculosis 38kDa Antibody indispensable in my work. Its high specificity and sensitivity make it a reliable tool for detecting M. tuberculosis in samples. The consistent quality across batches is commendable, ensuring that our results are both accurate and repeatable. Creative Biolabs' service has always been supportive, providing prompt assistance whenever needed.
Breast cancer biomarkers at key points during disease progression
Excellent Service and Product Quality
The quality offered by Creative Biolabs in their Recombinant Anti-M. tuberculosis 38kDa Antibody is exemplary. It integrates well into our workflow with no disruption, thanks to its stability and high specificity. Delivery is prompt, and the support team ensures all our concerns are duly addressed. This has undoubtedly increased our lab's efficiency in ongoing research projects.
Breast cancer biomarkers at key points during disease progression
Superior Detection in TB Pathogenesis Research
This antibody allows for superior detection in TB pathogenesis research. Its effectiveness in Western Blotting and ELISA is unmatched. Each order, backed by Creative Biolabs, arrives with precise documentation. Their customer service team has ensured a smooth transaction each time, proving them a partner truly dedicated to advancing scientific inquiry.

Q&As

  1. What are the primary research applications for the M. tuberculosis 38kDa antibody?

    A: The Recombinant Anti-M. tuberculosis 38kDa Antibody is predominantly used in the study of tuberculosis pathogenesis and immune response. It plays a critical role in identifying and characterizing the presence of the M. tuberculosis bacteria in various samples through techniques such as Western Blotting and ELISA. This aids researchers in understanding the bacterium's interactions with host cells, contributing to the development of diagnostic assays and potential therapeutic strategies.

  2. What diseases can be studied using this antibody?

    A: Primarily, this antibody facilitates the study of tuberculosis, particularly in terms of bacterial detection and immune system responses. It is instrumental in researching infection dynamics and host-pathogen interactions, which are critical for understanding tuberculosis pathogenesis and developing new diagnostic tools and vaccines.

  3. What role does the antibody play in protein interactions?

    A: Given its specificity, the antibody aids in elucidating protein-protein interactions involving the M. tuberculosis 38kDa antigen. These insights are valuable for understanding the molecular mechanisms of the bacterium's virulence and interaction with host immune factors, critical for advancing tuberculosis research.

View the frequently asked questions answered by Creative Biolabs Support.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "M. tuberculosis 38 kD"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
MRO-319-MZ Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM82) ELISA, WB Mouse antibody
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare