Mouse Anti-Abcc8 Recombinant Antibody (VS-0522-LC41) (CAT#: VS-0522-LC41)
This product is a mouse antibody that recognizes Abcc8 protein of Hamster, rat, mouse.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, cytosol & the Golgi apparatus.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/if_selected.jpg

(Immunohistochemical staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/11451/26292_B_9_6_selected.jpg

(Germinal center cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous Non-germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_8_8.jpg

(Neuronal cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_B_7_5.jpg

(Glandular cells Staining: High Intensity: Strong Quantity: 75%-25% Location: Cytoplasmic/ membranous Peripheral nerve/ganglion Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_9_3.jpg

(Exocrine glandular cells Staining: High Intensity: Strong Quantity:>75% Location: Cytoplasmic/ membranous Pancreatic endocrine cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/11451/26292_A_1_3.jpg

(Cells in glomeruli Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous Cells in tubules Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_7_5.jpg

(Cells in seminiferous ducts Staining: High Intensity: Strong Quantity:>75% Location: Cytoplasmic/ membranous nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_6_6.jpg

(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000006071-ABCC8
Specifications
- Immunogen
- A fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat Abcc8.
- Host Species
- Mouse
- Type
- Mouse IgG2a
- Specificity
- Rat Abcc8
- Species Reactivity
- Hamster, Rat, Mouse
- Applications
- WB
- Conjugate
- Unconjugated
- Related Disease
- Hyperinsulinemic Hypoglycemia, Familial, 1 and Hypoglycemia, Leucine-Induced
Product Property
- Purification
- Protein A purified
- Format
- Liquid
- Concentration
- 1 mg/ml
- Buffer
- PBS
- Preservative
- 0.02% Proclin 300
- Storage
- Store at 4°C for short term. For long term storage, store at-20°C, avoiding freeze/thaw cycles.
Applications
- Application Notes
- This antibody has been tested for use in Western Blot.
Target
- Alternative Names
- Sur; Sur1; ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; sulfonylurea receptor 1; sulphonylurea receptor 1
- Gene ID
- 25559
- UniProt ID
- Q09429
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "ABCC8"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MOB-2653z | Mouse Anti-ABCC8 Recombinant Antibody (clone 25H8) | WB, ELISA, IP | Mouse IgG2a, κ |
MOB-1992CT | Mouse Anti-ABCC8 Recombinant Antibody (clone EML1649) | WB | Mouse IgG2a |
VS-0522-LC42 | Rat Anti-Abcc8 Recombinant Antibody (VS-0522-LC42) | WB | Rat IgG2b |
VS-0522-LC43 | Rabbit Anti-Abcc8 Recombinant Antibody (VS-0522-LC43) | WB | Rabbit IgG |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for VS-0522-LC41. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: ELISA, IP, FC, FuncS, Neut, IF, WB
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: FC, IP, ELISA, Neut, FuncS, IF, WB
Application: WB, FC, IP, ELISA, Neut, FuncS, IF
Application: FC, IP, ELISA, Neut, FuncS, IF, IHC
Application: IB, ELISA, FC, FuncS
Application: ELISA
Application: ELISA, FC, WB, FuncS
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: ELISA, Neut
Application: ELISA, FC, Inhib
Application: ELISA, WB, IF, FC, IP
For Research Use Only. Not For Clinical Use.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.