Mouse Anti-Abcc8 Recombinant Antibody (VS-0522-LC41)
CAT#: VS-0522-LC41
This product is a mouse antibody that recognizes Abcc8 protein of Hamster, rat, mouse.
Specifications
- Immunogen
- A fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat Abcc8.
- Host Species
- Mouse
- Type
- Mouse IgG2a
- Specificity
- Rat Abcc8
- Species Reactivity
- Hamster, Rat, Mouse
- Applications
- WB
- Conjugate
- Unconjugated
- Related Disease
- Hyperinsulinemic Hypoglycemia, Familial, 1 and Hypoglycemia, Leucine-Induced
Product Property
- Purification
- Protein A purified
- Format
- Liquid
- Concentration
- 1 mg/ml
- Buffer
- PBS
- Preservative
- 0.02% Proclin 300
- Storage
- Store at 4°C for short term. For long term storage, store at-20°C, avoiding freeze/thaw cycles.
Applications
- Application Notes
- This antibody has been tested for use in Western Blot.
Target
- Alternative Names
- Sur; Sur1; ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; sulfonylurea receptor 1; sulphonylurea receptor 1
- Gene ID
- 25559
- UniProt ID
- Q09429
Customer Review
There are currently no Customer reviews or questions for VS-0522-LC41. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "ABCC8"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-2653z | Mouse Anti-ABCC8 Recombinant Antibody (clone 25H8) | WB, ELISA, IP | Mouse IgG2a, κ |
| MOB-1992CT | Mouse Anti-ABCC8 Recombinant Antibody (clone EML1649) | WB | Mouse IgG2a |
| VS-0522-LC42 | Rat Anti-Abcc8 Recombinant Antibody (VS-0522-LC42) | WB | Rat IgG2b |
| VS-0522-LC43 | Rabbit Anti-Abcc8 Recombinant Antibody (VS-0522-LC43) | WB | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY31 | Anti-ABCC8 Immunohistochemistry Kit | IHC | |
| VS-0525-XY32 | Anti-Mouse ABCC8 Immunohistochemistry Kit | IHC |
Popular Products

Application: FuncS, IF, Neut, ELISA, FC, IP, IHC

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: ELISA, SPR, Inhib, FuncS

Application: Neut, Inhib, FC, ELISA

Application: ELISA, FC, IF, IHC, WB
-3.jpg)
Application: ELISA, WB
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

















