1 0
Cart
    Inquiry
    Popular Searches: Recombinant Antibody MHC Tetramer T cell Receptor Scaffold Protein

    Mouse Anti-Abcc8 Recombinant Antibody (VS-0522-LC41) (CAT#: VS-0522-LC41)

    This product is a mouse antibody that recognizes Abcc8 protein of Hamster, rat, mouse.

    Specific Inquiry
    • Size:

    • Conjugation:

    • Endotoxin:

    • Purity:

    • Formats:

    • Isotype Switching:

    • Fc Engineering:

    • Modalities:

    Custom Production

    We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

    Sequences:
    Isotype :
    Purity :
    Endotoxin :
    Quantity :
    Conjugation :
    Fc Engineering :
    Modalities :
    Other Requirements:
    We require custom production
    • Gene Expression
    • Datasheet
    • MSDS
    • COA
    Subcellular Location
    Figure 1 IF staining of human cell line U-2 OS
    Figure 1 IF staining of human cell line U-2 OS
    (Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, cytosol & the Golgi apparatus.)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/if_selected.jpg
    Normal Tissue
    Figure 2 IHC staining of human hippocampus
    Figure 2 IHC staining of human hippocampus
    (Immunohistochemical staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/11451/26292_B_9_6_selected.jpg
    Figure 3 Lymph node
    Figure 3 Lymph node
    (Germinal center cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous Non-germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_8_8.jpg
    Figure 4 Cerebral cortex
    Figure 4 Cerebral cortex
    (Neuronal cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_B_7_5.jpg
    Figure 5 Colon
    Figure 5 Colon
    (Glandular cells Staining: High Intensity: Strong Quantity: 75%-25% Location: Cytoplasmic/ membranous Peripheral nerve/ganglion Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_9_3.jpg
    Figure 6 Pancreas
    Figure 6 Pancreas
    (Exocrine glandular cells Staining: High Intensity: Strong Quantity:>75% Location: Cytoplasmic/ membranous Pancreatic endocrine cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/11451/26292_A_1_3.jpg
    Figure 7 Kidney
    Figure 7 Kidney
    (Cells in glomeruli Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous Cells in tubules Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_7_5.jpg
    Figure 8 Testis
    Figure 8 Testis
    (Cells in seminiferous ducts Staining: High Intensity: Strong Quantity:>75% Location: Cytoplasmic/ membranous nuclear)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_6_6.jpg
    RNA Expression
    Figure 9 RNA cell line category: Group enriched (A549, AN3-CA, SCLC-21H)
    Figure 9 RNA cell line category: Group enriched (A549, AN3-CA, SCLC-21H)
    (Cell lines ordered by descending RNA expression order)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000006071-ABCC8

    Specifications

    • Immunogen
    • A fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat Abcc8.
    • Host Species
    • Mouse
    • Type
    • Mouse IgG2a
    • Specificity
    • Rat Abcc8
    • Species Reactivity
    • Hamster, Rat, Mouse
    • Applications
    • WB
    • Conjugate
    • Unconjugated
    • Related Disease
    • Hyperinsulinemic Hypoglycemia, Familial, 1 and Hypoglycemia, Leucine-Induced

    Product Property

    • Purification
    • Protein A purified
    • Format
    • Liquid
    • Concentration
    • 1 mg/ml
    • Buffer
    • PBS
    • Preservative
    • 0.02% Proclin 300
    • Storage
    • Store at 4°C for short term. For long term storage, store at-20°C, avoiding freeze/thaw cycles.

    Applications

    • Application Notes
    • This antibody has been tested for use in Western Blot.

    Target

    • Alternative Names
    • Sur; Sur1; ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; sulfonylurea receptor 1; sulphonylurea receptor 1

    Product Notes

    This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

    • Increased sensitivity
    • Confirmed specificity
    • High repeatability
    • Excellent batch-to-batch consistency
    • Sustainable supply
    • Animal-free production

    See more details about Hi-Affi™ recombinant antibody benefits.

    Downloads

    Download resources about recombinant antibody development and antibody engineering to boost your research.

    See other products for "ABCC8"

    Select a product category from the dropdown menu below to view related products.
    Please select product type
    IgG Antibody Products
    CAT Product Name Application Type
    MOB-2653z Mouse Anti-ABCC8 Recombinant Antibody (clone 25H8) WB, ELISA, IP Mouse IgG2a, κ
    MOB-1992CT Mouse Anti-ABCC8 Recombinant Antibody (clone EML1649) WB Mouse IgG2a
    VS-0522-LC42 Rat Anti-Abcc8 Recombinant Antibody (VS-0522-LC42) WB Rat IgG2b
    VS-0522-LC43 Rabbit Anti-Abcc8 Recombinant Antibody (VS-0522-LC43) WB Rabbit IgG

    Customer Reviews and Q&As

    Submit a review or a question

    There are currently no Customer reviews or questions for VS-0522-LC41. Click the button above to contact us or submit your feedback about this product.

    Popular products with customers

    Figure 1 Anti-SLAMF7 Recombinant Antibody (TAB-743) in ELISA

    Anti-SLAMF7 Recombinant Antibody (Elotuzumab) (CAT# TAB-743)
    Application: FuncS, IF, Neut, ELISA, FC, IP, IHC

    Figure 2 Anti-Human Met (TAB-190-F(E)) in ELISA

    Anti-Human Met(Onartuzumab) (CAT# TAB-190-F(E))
    Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

    Figure 1 Anti-Human IL23 Antibody (TAB-875) in SDS-PAGE

    Anti-Human IL23 Recombinant Antibody (Tildrakizumab) (CAT# TAB-875)
    Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

    Figure 1 Anti-Human IL4 Recombinant Antibody (TAB-221) in ELISA

    Anti-Human IL4 Recombinant Antibody (TAB-221) (CAT# TAB-221)
    Application: WB, ELISA, FC, IP, FuncS, IF, Neut

    Figure 1 Anti-Human CD33 Antibody in WB

    Anti-CD33 Recombinant Antibody (TAB-756) (CAT# TAB-756)
    Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

    Figure 1 Anti-Human HSP90 Recombinant Antibody (TAB-368CL) in WB

    Anti-Human HSP90 Recombinant Antibody (CAT# TAB-368CL)
    Application:

    Figure 1 Recombinant Anti-1,3-Beta-glucan Antibody (MOB-0228MC) in SDS-PAGE

    Recombinant Anti-1,3-Beta-glucan Antibody (CAT# MOB-0228MC)
    Application: ELISA, WB, IP, FuncS

    Figure 1 Recombinant Anti-HIV env Antibody (PABL-179) in SDS-PAGE

    Human Anti-HIV-1 gp160 Recombinant Antibody (clone PGT128) (CAT# PABL-179)
    Application: WB, ELISA, FuncS

    Figure 1 Recombinant Human Anti-H3N2 HA Antibody (F045-092) (PABC-233) in SDS-PAGE

    Recombinant Human Anti-H3N2 HA Antibody (F045-092) (CAT# PABC-233)
    Application: Neut

    Figure 1 Anti-Mouse F11 Recombinant Antibody (TAB-020WM) in SDS-PAGE

    Mouse Anti-F11 Recombinant Antibody (TAB-020WM) (CAT# TAB-020WM)
    Application: WB

    Figure 1 Anti-Human RAGE Recombinant Antibody (TAB-293CT) in WB

    Anti-Human RAGE Recombinant Antibody (XT-M4) (CAT# TAB-293CT)
    Application: WB, ELISA, Neut, PK

    Figure 1 Human Anti-SLC34A2 Recombinant Antibody (TAB-468MZ) in SDS-PAGE

    Human Anti-SLC34A2 Recombinant Antibody (TAB-468MZ) (CAT# TAB-468MZ)
    Application: FC, Inhib

    Figure 1 Anti-SARS-CoV S Recombinant Antibody (MRO-654LC) in SDS-PAGE

    Mouse Anti-SARS-CoV S Recombinant Antibody (MRO-654LC) (CAT# MRO-654LC)
    Application: ELISA

    Figure 1 Anti-Human FCRL5 Antibody in SDS-PAGE

    Mouse Anti-FCRL5 Recombinant Antibody (MOB-056CQ) (CAT# MOB-056CQ)
    Application: ELISA, FC, FuncS

    Figure 1 Mouse Anti-MICA/B Recombinant Antibody (PABC-516) in SDS-PAGE

    Mouse Anti-MICA/B Recombinant Antibody (PABC-516) (CAT# PABC-516)
    Application: ELISA

    Figure 1 Human Anti-HLA-DR4 Recombinant Antibody (HPAB-0827-FY) in SDS-PAGE

    Human Anti-HLA-DR4/GAD-555-567 Recombinant Antibody (clone G1H12) (CAT# HPAB-0827-FY)
    Application: FC

    Figure 1 Mouse Anti-dsRNA Recombinant Antibody (FAMAB-1747CQ) in SDS-PAGE

    Mouse Anti-dsRNA Recombinant Antibody (clone 9D5) (CAT# FAMAB-1747CQ)
    Application: WB, ELISA, IHC

    Figure 1 Human Anti-SIRPA Antibody (PABJ-0078) in ELISA

    Human Anti-SIRPA Recombinant Antibody (PABJ-0078) (CAT# PABJ-0078)
    Application: ELISA

    Figure 1 Anti-IAV H2N2 NA Recombinant Antibody (PABJ-0221) in SDS-PAGE

    Human Anti-IAV H2N2 NA Recombinant Antibody (PABJ-0221) (CAT# PABJ-0221)
    Application: ELISA, Inhib, FuncS

    Figure 1 Mouse Anti-MUC16 Recombinant Antibody (ZG-0056J) in IHC

    Mouse Anti-MUC16 Recombinant Antibody (ZG-0056J) (CAT# ZG-0056J)
    Application: IHC-P, IF

    For Research Use Only. Not For Clinical Use.

    For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

    Send Inquiry

    This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

    Go to compare

    Go to compare