Mouse Anti-Abcc8 Recombinant Antibody (VS-0522-LC41) (CAT#: VS-0522-LC41)

This product is a mouse antibody that recognizes Abcc8 protein of Hamster, rat, mouse.


Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location
Normal Tissue
RNA Expression

Specifications

  • Immunogen
  • A fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat Abcc8.
  • Host Species
  • Mouse
  • Type
  • Mouse IgG2a
  • Specificity
  • Rat Abcc8
  • Species Reactivity
  • Hamster, Rat, Mouse
  • Applications
  • WB
  • Conjugate
  • Unconjugated
  • Related Disease
  • Hyperinsulinemic Hypoglycemia, Familial, 1 and Hypoglycemia, Leucine-Induced

Product Property

  • Purification
  • Protein A purified
  • Format
  • Liquid
  • Concentration
  • 1 mg/ml
  • Buffer
  • PBS
  • Preservative
  • 0.02% Proclin 300
  • Storage
  • Store at 4°C for short term. For long term storage, store at-20°C, avoiding freeze/thaw cycles.

Applications

  • Application Notes
  • This antibody has been tested for use in Western Blot.

Target

  • Alternative Names
  • Sur; Sur1; ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; sulfonylurea receptor 1; sulphonylurea receptor 1

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "ABCC8"

Customer Reviews and Q&As

Submit a review or a question
There are currently no Customer reviews or questions for VS-0522-LC41. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0
Cart

    Go to compare