Mouse Anti-M. tuberculosis 38 kD Antibody, mRNA (MRO-318-MZ-mRNA) (CAT#: MRO-318-MZ-mRNA)

This mRNA encodes a Mouse antibody against M. tuberculosis 38 kD. It contains two mRNAs that encode for the heavy and light chains of the antibody.

Specific Inquiry
  • Size:

Custom Production

We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

Sequences:
Isotype :
Purity :
Endotoxin :
Quantity :
Conjugation :
Fc Engineering :
Modalities :
Other Requirements:
We require custom production
  • Datasheet
  • MSDS
  • COA

Specifications

  • Immunogen
  • Recombinant full length protein corresponding to Mycobacterium tuberculosis 38kDa aa 1-340
    Sequence:
    MELGSLIRATNLWGYTDLMRELGADPLPFLRRFDIPPGIEHQEDAFMSLA GFVRMLEASAAELDCPDFGLRLARWQGLGILGPVAVIARNAATLFGGLEA IGRYLYVHSPALTLTVSSTTARSNVRFGYEVTEPGIPYPLQGYELSMANA ARMIRLLGGPQARARVFSFRHAQLGTDAAYREALGCTVRFGRTWCGFEVD HRLAGRPIDHADPETKRIATKYLESQYLPSDATLSERVVGLARRLLPTGQ CSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGLY LSQIAVLLGYSEQSALNRSCRRWFGMTPRQYRAYGGVSGR
  • Host Species
  • Mouse
  • Specificity
  • M. tuberculosis 38 kD
  • Species Reactivity
  • Mycobacterium tuberculosis

Product Property

  • Purity
  • >95%
  • Storage
  • Store at -20°C.

Target

  • Alternative Names
  • Mycobacterium tuberculosis 38kDa

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "M. tuberculosis 38 kD"

Select a product category from the dropdown menu below to view related products.
Please select product type
IgG Antibody Products
CAT Product Name Application Type
MRO-318-MZ Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM81) WB, ELISA Mouse antibody
MRO-319-MZ Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM82) ELISA, WB Mouse antibody

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for MRO-318-MZ-mRNA. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare