Mouse Anti-M. tuberculosis 38 kD Antibody, mRNA (MRO-318-MZ-mRNA) (CAT#: MRO-318-MZ-mRNA)
This mRNA encodes a Mouse antibody against M. tuberculosis 38 kD. It contains two mRNAs that encode for the heavy and light chains of the antibody.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.
Specifications
- Immunogen
- Recombinant full length protein corresponding to Mycobacterium tuberculosis 38kDa aa 1-340
Sequence:
MELGSLIRATNLWGYTDLMRELGADPLPFLRRFDIPPGIEHQEDAFMSLA GFVRMLEASAAELDCPDFGLRLARWQGLGILGPVAVIARNAATLFGGLEA IGRYLYVHSPALTLTVSSTTARSNVRFGYEVTEPGIPYPLQGYELSMANA ARMIRLLGGPQARARVFSFRHAQLGTDAAYREALGCTVRFGRTWCGFEVD HRLAGRPIDHADPETKRIATKYLESQYLPSDATLSERVVGLARRLLPTGQ CSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGLY LSQIAVLLGYSEQSALNRSCRRWFGMTPRQYRAYGGVSGR
- Host Species
- Mouse
- Specificity
- M. tuberculosis 38 kD
- Species Reactivity
- Mycobacterium tuberculosis
Product Property
- Purity
- >95%
- Storage
- Store at -20°C.
Target
- Alternative Names
- Mycobacterium tuberculosis 38kDa
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "M. tuberculosis 38 kD"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MRO-318-MZ | Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM81) | WB, ELISA | Mouse antibody |
MRO-319-MZ | Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM82) | ELISA, WB | Mouse antibody |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for MRO-318-MZ-mRNA. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: ELISA, IP, FC, FuncS, Neut, IF, ICC
Application: WB, FC, IP, ELISA, Neut, FuncS, IF
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: WB, IF, FuncS
Application: ELISA, Inhib, FC
Application: ELISA, IHC, FC, IP, IF, Inhib
Application: ELISA, PD, Activ, PK, Stim
Application: Neut, IHC, Activ, FuncS, IF, ELISA
Application: ELISA, FuncS, Neut, IF, WB, EM, Inhib, IHC
Application: ELISA, FC, Inhib, IHC-Fr, WB, IP
Application: ELISA, Block, WB, FC, IP
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.