Mouse Anti-M. tuberculosis 38 kD Antibody, mRNA (MRO-318-MZ-mRNA)
CAT#: MRO-318-MZ-mRNA
This mRNA encodes a Mouse antibody against M. tuberculosis 38 kD. It contains two mRNAs that encode for the heavy and light chains of the antibody.
Specifications
- Immunogen
- Recombinant full length protein corresponding to Mycobacterium tuberculosis 38kDa aa 1-340
Sequence:
MELGSLIRATNLWGYTDLMRELGADPLPFLRRFDIPPGIEHQEDAFMSLA GFVRMLEASAAELDCPDFGLRLARWQGLGILGPVAVIARNAATLFGGLEA IGRYLYVHSPALTLTVSSTTARSNVRFGYEVTEPGIPYPLQGYELSMANA ARMIRLLGGPQARARVFSFRHAQLGTDAAYREALGCTVRFGRTWCGFEVD HRLAGRPIDHADPETKRIATKYLESQYLPSDATLSERVVGLARRLLPTGQ CSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGLY LSQIAVLLGYSEQSALNRSCRRWFGMTPRQYRAYGGVSGR
- Host Species
- Mouse
- Specificity
- M. tuberculosis 38 kD
- Species Reactivity
- Mycobacterium tuberculosis
Product Property
- Purity
- >95%
- Storage
- Store at -20°C.
Target
- Alternative Names
- Mycobacterium tuberculosis 38kDa
Customer Review
There are currently no Customer reviews or questions for MRO-318-MZ-mRNA. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "M. tuberculosis 38 kD"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MRO-318-MZ | Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM81) | WB, ELISA | Mouse antibody |
MRO-319-MZ | Recombinant Anti-M. tuberculosis 38kDa Antibody (HTM82) | ELISA, WB | Mouse antibody |
Popular Products
Application: FC, IP, ELISA, Neut, FuncS, IF, IHC
Application: Neut, ELISA, Inhib, ICC, WB
Application: FuncS, Inhib, IP, ELISA
Application: IB, ELISA, FC, FuncS
Application: ELISA, IHC, FC, IP, IF, Inhib
Application: ELISA, WB, FC
Application: ELISA, FC, IF, IHC, WB
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.