This product is a mouse monoclonal antibody that specifically recognizes VIEEWAAKVRGDVNITDQFSVWLQGAYSSAATPDQNYGQWG, which is an linear epitope on Porin Omp2b from Brucella melitensis. The omp2b-binding antibody is an epitope-specific antibody that can be used in ELISA.
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Download resources about recombinant antibody development and antibody engineering to boost your research.
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
EPAF-1287LC | Recombinant Mouse Anti-B. melitensis omp2b Antibody (A68) | ELISA |
There are currently no Customer reviews or questions for EPAF-1493LC. Click the button above to contact us or submit your feedback about this product.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.