Recombinant Mouse Anti-P. falciparum MSP1 Antibody (111.4)
CAT#: EPAF-1324LC
This product is a mouse monoclonal antibody that specifically recognizes NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQEGDKCVENPNPT, which is an linear epitope on Major merozoite surface protein from Plasmodium falciparum. The MSP1-binding antibody 111.4 is an epitope-specific antibody that can be used in western blotting.
Specifications
- Host Species
- Mouse
- Type
- IgG
- Specificity
- Plasmodium falciparum Major merozoite surface protein
- Species Reactivity
- P. falciparum
- Clone
- 111.4
- Applications
- Western Blot
Target
- Alternative Names
- P. falciparum MSP1; Plasmodium falciparum; P. falciparum; MSP1; Major merozoite surface protein
- UniProt ID
- Q25976
REVIEWS AND Q&AS
CITATIONS
RESOURCES
DOWNLOADS
RELATED PRODUCTS
Inquiry
Navs
Customer Review
There are currently no Customer reviews or questions for EPAF-1324LC. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number:
See other products for "P. falciparum MSP1"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-675 | Recombinant Anti-P. falciparum MSP1 Antibody | ELISA, IP, FuncS | IgG |
| MHH-675 | Recombinant Human Anti-P. falciparum MSP1 Antibody | WB, ELISA, IHC, FuncS | IgG |
| MOB-0201MZ | Recombinant Mouse Anti-Plasmodium Falciparum MSP1 Antibody (clone C937P) | ELISA, WB | Mouse antibody |
| HPAB-1996-FY | Human Anti-P. falciparum MSP1 Recombinant Antibody (clone MK3) | IF | Human IgG |
| FAMAB-1485CQ | Rabbit Anti-P. falciparum MSP1 Recombinant Antibody (clone 5.2) | IB, IP, ELISA, IF | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-675-F(E) | Recombinant Anti-P. falciparum MSP1 Antibody Fab Fragment | RIA, WB, FuncS | Fab |
| MHH-675-F(E) | Recombinant Human Anti-P. falciparum MSP1 Antibody Fab Fragment | WB, IP, FuncS | Fab |
| HPAB-1996-FY-F(E) | Human Anti-P. falciparum MSP1 Recombinant Antibody (clone MK3); Fab Fragment | IF | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-675-S(P) | Recombinant Anti-P. falciparum MSP1 Antibody scFv Fragment | WB, IHC, FuncS | scFv |
| MHH-675-S(P) | Recombinant Human Anti-P. falciparum MSP1 Antibody scFv Fragment | FC, Neut, Biosensors, FuncS | scFv |
| HPAB-1996-FY-S(P) | Human Anti-P. falciparum MSP1 Recombinant Antibody (clone MK3); scFv Fragment | IF | Human scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| EPAF-0104LC | Recombinant Mouse Anti-P. falciparum Msp1 Antibody (2F10) | ELISA | IgG1 |
| EPAF-0105LC | Recombinant Mouse Anti-P. falciparum Msp1 Antibody (12.1) | ELISA | IgG1 |
| EPAF-0106LC | Recombinant Mouse Anti-P. falciparum Msp1 Antibody (12.8) | ELISA | IgG2b |
Specific Inquiry
Add to compare
See Our Custom Production in Action
Popular Products
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: IF, IP, Neut, FuncS, ELISA, FC, WB
Application: Neut, ELISA, FuncS
Application: ELISA
Application: FC, ADCC, CDC, Inhib
Application: ELISA, IHC, FC, IP, IF, Inhib
Application: ELISA, IHC, FC, IP, IF, FuncS
-3.jpg)
Application: Neut
Application: WB, ELISA, IHC, IP, SPR, FuncS
-4.jpg)
Application: FC, FuncS, IA, IF, IP, IHC
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
