Rabbit Anti-MARV GP Antibody
CAT#: MOB-0335MC
Polyclonal Rabbit Antibody specifically binds to MARV GP.
Specifications
- Immunogen
- Synthetic peptide within MARV GP aa 436-681. The exact sequence is proprietary. Sequence is specific to the GP2 subunit.
Sequence:
SILWREGDMFPFLDGLINAPIDFDPVPNTKTIFDESSSSGASAEEDQHAS PNISLTLSYFPNINENTAYSGENENDCDAELRIWSVQEDDLAAGLSWIPF FGPGIEGLYTAVLIKNQNNLVCRLRRLANQTAKSLELLLRVTTEERTFSL INRHAIDFLLTRWGGTCKVLGPDCCIGIEDLSKNISEQIDQIKKDEQKEG TGWGLGGKWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG
- Host Species
- Rabbit
- Species Reactivity
- Reacts with: Other
- Conjugate
- Biotin
Product Property
- Purification
- Immunoaffinity purified
- Format
- Liquid
- Concentration
- 50 µg at 0.746 mg/ml
- Storage
- Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.
Target
REVIEWS AND Q&AS
CITATIONS
RESOURCES
DOWNLOADS
RELATED PRODUCTS
Inquiry
Navs
Customer Review
There are currently no Customer reviews or questions for MOB-0335MC. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number:
See other products for "MARV GP"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| EPAF-0806CQ | Recombinant Mouse Anti-MARV GP Antibody (7G8) | WB, ELISA | IgG |
| EPAF-0807CQ | Recombinant Mouse Anti-MARV GP Antibody (3H5) | WB, Inhib | IgG |
| EPAF-0808CQ | Recombinant Mouse Anti-MARV GP Antibody (7E10) | WB, IP | IgG |
| EPAF-0809CQ | Recombinant Mouse Anti-MARV GP Antibody (7E9) | WB, IP | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0618WJ | Human Anti-MARV GP Recombinant Antibody (FAMAB-0618WJ) | ELISA, WB, Neut | Human IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0125-FY99 | Mouse Anti-MARV GP (clone CAN30G5) scFv-Fc Chimera | Neut | Mouse IgG2, scFv-Fc |
Specific Inquiry
Add to compare
See Our Custom Production in Action
Popular Products
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: Neut, ELISA, IF, IP, FuncS, FC, IHC
Application: IF, IP, Neut, FuncS, ELISA, FC, WB
Application: ELISA, Neut, IF, IP, FC, FuncS
-2.png)
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application:
-2.jpg)
Application: IB, ELISA, FC, FuncS
Application: ELISA, IHC, FC, IP, IF, Inhib
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: ELISA, FC, IHC, Neut
Application: IF, IP, Neut, FuncS, ELISA, FC
Application: FC
Application: ELISA, WB
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
