Rabbit Anti-MARV GP Antibody (CAT#: MOB-0335MC)

Polyclonal Rabbit Antibody specifically binds to MARV GP.

Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Formats:
  • Isotype Switching:
  • Fc Engineering:
  • Modalities:
  • Datasheet
  • MSDS
  • COA

Specifications

  • Immunogen
  • Synthetic peptide within MARV GP aa 436-681. The exact sequence is proprietary. Sequence is specific to the GP2 subunit.
    Sequence:
    SILWREGDMFPFLDGLINAPIDFDPVPNTKTIFDESSSSGASAEEDQHAS PNISLTLSYFPNINENTAYSGENENDCDAELRIWSVQEDDLAAGLSWIPF FGPGIEGLYTAVLIKNQNNLVCRLRRLANQTAKSLELLLRVTTEERTFSL INRHAIDFLLTRWGGTCKVLGPDCCIGIEDLSKNISEQIDQIKKDEQKEG TGWGLGGKWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG
  • Host Species
  • Rabbit
  • Species Reactivity
  • Reacts with: Other
  • Conjugate
  • Biotin

Product Property

  • Purification
  • Immunoaffinity purified
  • Format
  • Liquid
  • Concentration
  • 50 µg at 0.746 mg/ml
  • Storage
  • Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.

Target

  • Alternative Names
  • Envelope glycoprotein; GP1; GP1,2; GP2; Marburg virus; Virion spike glycoprotein

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "MARV GP"

Select a product category from the dropdown menu below to view related products.
Please select product type
Epitope-Specific Antibody Products IgG Antibody Products ScFv-Fc Chimera Products

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for MOB-0335MC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

  • 0
  • 0
Cart
    Go to compare

    Go to compare